CAZyme Information: P170DRAFT_351408-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_351408-t37_1-p1
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MSFO01000002|CGC36	53699.60	6.0804

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:6109391-6110865(-)

Full Sequence      

MGAIMSHKTTNVLYVVLLLVIAASVLDLQLGTQSLDSTSLYHRRPNKHDYEPDYWTWETT
TRFKQPDTRSRFTIDDDAICDSFPTHLLSRVQVVLKIGSSEAKDRLNAQLATVTRCISNL
LIVSDRESELNGHQVYDILGSLPASFRNNTPDFDAYDALQQGKTVDPAQGWRLDRFKFLP
MVEAAYETNPTAEWFVFLESDTYYVWDNLFRLLDQFNPSVPLYFGSPTPGRGAGEERTFF
AYGGAGFVLSKGAVERLVARGTGSHGEYIEPSLSVRYEDVVKGDCCGDSVLGWALYDHGV
KLSGMWPMFNPHPLHGIPFDNAYWCQPVISMHKSFLNDMEDLVKWENRRDRSTPLLYSDL
FSYLKLGVLTQKSEWDNGDWGGFLEPPDSPAHRSFDDCREACHEHGECLSYTYDFAGHCV
FVRTMRLGSRKPHTPEVKLSAGWDVQKIKTWRANHQCEKPLWMKPSITRIF

Enzyme Prediction     

No EC number prediction in P170DRAFT_351408-t37_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	3.87e-07	193	285	86	181	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	3.57e-04	190	257	209	277	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD57328.1|GT31	9.73e-243	4	471	5	477
QMW44383.1|GT31	1.13e-241	4	471	5	477
BAE62206.1|GT31	2.28e-241	4	471	5	477
QRD83812.1|GT31	6.51e-241	4	471	5	477
QMW32351.1|GT31	6.51e-241	4	471	5	477

PDB Hits     

P170DRAFT_351408-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0VC84|C1GLT_BOVIN	3.33e-06	192	258	162	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1
sp|Q9JJ05|C1GLT_RAT	4.35e-06	192	258	162	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=C1galt1 PE=1 SV=1
sp|Q9JJ06|C1GLT_MOUSE	5.78e-06	192	258	162	224	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=C1galt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.140892	0.859074	CS pos: 31-32. Pr: 0.7099

TMHMM  Annotations     

Start	End
12	31