CAZyme Information: P170DRAFT_351023-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_351023-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		38039.18	4.2684

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:485080-486314(+)

Full Sequence      

MKPFVPLLFPTSALAGSVLWSGVFNSSDSVADLDDWSWSNQVGAYQWYIHGDGKTSEYLE
LSSDLKNPAASDAKGLRTSIDGTATWNGQTMERTELIPQTSSDLGSGHLYYHFSLSTKTT
NAPSPSFEHQIAFFESHFTELQYGSSGGKDNTLRWNAGGETQWSVQLEAGHWYNFAYDID
FDAQKVGLWASNGSDALTQVVKPVSADASSNSADWHVGVLRLPGSSSSDEQEDFFWSGVY
VEEGPITTKIGSGRSSDSNSDASSEASTTQTSAVSASTTFEAVSTAEPTGTSAAASSASA
AVTTSAVPTPVPTETTPASTTTSSASLPSPTTASELLADIGSLLKSLISRSGVHARDFTR

Enzyme Prediction     

No EC number prediction in P170DRAFT_351023-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	18	253	1.1e-98	0.996078431372549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	2.61e-71	18	242	1	246	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW46856.1|GH131	2.82e-144	1	360	1	377
QMW34786.1|GH131	8.03e-144	1	360	1	377
QRD91104.1|GH131	8.03e-144	1	360	1	377
UDD63765.1|GH131	8.03e-144	1	360	1	377
BAE64574.1|GH131	4.33e-141	1	256	1	257

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LE3_A	5.77e-94	16	250	1	240	Chain A, Beta-glucanase [Podospora anserina],4LE3_B Chain B, Beta-glucanase [Podospora anserina],4LE3_C Chain C, Beta-glucanase [Podospora anserina],4LE3_D Chain D, Beta-glucanase [Podospora anserina],4LE4_A Chain A, Beta-glucanase [Podospora anserina],4LE4_B Chain B, Beta-glucanase [Podospora anserina],4LE4_C Chain C, Beta-glucanase [Podospora anserina],4LE4_D Chain D, Beta-glucanase [Podospora anserina]
3W9A_A	6.30e-89	16	253	1	234	Chain A, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_B Chain B, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_C Chain C, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130],3W9A_D Chain D, Crystal structure of the catalytic domain of the glycoside hydrolase family 131 protein from Coprinopsis cinerea [Coprinopsis cinerea okayama7#130]

Swiss-Prot Hits     

P170DRAFT_351023-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.217718	0.782275	CS pos: 15-16. Pr: 0.7502

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_351023-t37_1-p1.