CAZyme Information: P170DRAFT_349180-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_349180-t37_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MSFO01000002|CGC23	35719.42	6.7597

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:3949399-3950361(+)

Full Sequence      

MQLVVPRPRTSSGTTPTSDVSNPQQSLSPSGLKNLSVDSNTAIWRIPDKVWHSAKDENVS
EQQRGWINSWTKTNPSCRQELLTDRSGEEFVRIHFQETRPDIVEVYQAIPIPILRADLLR
YLIVLAEGGYWSDLDVTSKKPNSHWVPSEYKTRNIDMVVGLEFDFAYRGPGTEVASQFCN
WVFAAQPSSRNLQIIVDSVISKLKEVAQANGVAVSGIKLEMLKDVVNVTGPKIMTIAILE
SLGQLLGRTVDDRDFSGIKHPKLIGDVLIMPAVSFAASQNGYPTDQGYALVTHHYEGSWK
QADAEAKARKKQKEQEQQTQ

Enzyme Prediction     

No EC number prediction in P170DRAFT_349180-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	64	148	1.5e-17	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.09e-15	46	302	82	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	8.87e-12	60	150	1	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK48128.1|GT32	3.23e-154	1	304	36	344
CAK46331.1|GT32	1.23e-127	23	304	122	404
BCS14453.1|GT32	9.46e-126	16	304	64	356
BCS02801.1|GT32	2.93e-125	16	304	98	390
QKX62870.1|GT32	2.84e-113	21	303	84	367

PDB Hits     

P170DRAFT_349180-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.26e-31	46	300	142	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.69e-21	46	300	99	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.88e-21	45	300	129	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	3.22e-11	46	215	96	298	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998649	0.001389

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_349180-t37_1-p1.