CAZyme Information: P170DRAFT_346347-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_346347-t37_1-p1
• CAZy Family: AA3
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817		88742.81	6.3436

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:6346997-6349515(-)

Full Sequence      

MRILSSFLVGQFLAWHALASCSSKLTRPLSYTVNGNSIPVHENTTLKLSSNGTTPSILIL
DYGRNVEGLASFEVAHRTGDTSVFEMSYGESRAVLDSYMSDGPLDFSAAMDTYRINRYNL
SSGSESVHTNRLIQGGLRYQKLNLSTAGELELSSIGFRPTVDDTPLSKLPGAFRCSDPVL
TRIWEVGARTMQLNEFPANSLPDFWVITEEGAFVESLSPQPFSADYASAMTAFELDFVAK
PIRNGFGFTVLSDTLGKGIYLFVNIANSSISAHAGSSELSDSLVVAPLPPSVSLGHWHRV
HSSVDSSQISISIDGSTVLNFTQTTSFFGSFGLGASLHHAAMFTNVSLTAFGTEMYSSRL
NSKSDLQAFLIGTNPLPVEVDGSRRDRIAYAGDLDMTTGSALASTYGREYINGTISLLGS
FQLLPGFFVPTAKVQQPPRSADLSANITGLIGYSFSMVSAMAQYYEQTGETDFVSRWGPK
AARMLDWAHSQVLPNGILNISNQAFAGDWNYYDPPVGGEVAKFNLIYASTLKKWIPLMDD
AGLNSTLYMRRLDALRAAINRHLWSNSLQAYYHSDTHRDFFSQEANALAILSDTIPVNGT
GNFTARALLSTMARELDVPAGPLAFSPASKASGWAQMISPYSSGYHLQAAFHARDGPAAK
HLLQTLWGPMSDPKHTNYTGCFWEVLGEDGTPGLGSGTSLCHAWSAAPTAALSRYVLGVA
PAKAGYSEWTITPQTLDLRWAEGRYPVPQGAFEVKWRYDSSDFLHMTVTPPAGTKGTVYL
PAPMRRKVRKYEVTGGVANRDGGFTVGDTEFVFQQTA

Enzyme Prediction     

No EC number prediction in P170DRAFT_346347-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	376	780	9.2e-68	0.7321428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	2.98e-10	718	796	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	6.85e-04	374	716	27	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD63660.1|GH78	0.0	42	816	260	1030
QMW46762.1|GH78	0.0	42	816	47	817
QRD93478.1|GH78	0.0	42	816	243	1013
QMW34696.1|GH78	0.0	42	816	47	817
CAK96693.1|GH78	0.0	17	817	18	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.53e-21	380	787	331	699	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	2.54e-18	453	788	629	949	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

P170DRAFT_346347-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000430	0.999570	CS pos: 20-21. Pr: 0.9501

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_346347-t37_1-p1.