CAZyme Information: P170DRAFT_343506-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_343506-t37_1-p1
• CAZy Family: AA3
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		65688.73	4.5952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:6660524-6662707(+)

Full Sequence      

MALLRAFSFLSLLAASTATGPFEAPATSLGTPGKDASYDYVVVGGGTAGLTIAGRLAQEG
GFTVAVVEAGGFYQLNGNLSVIPAFDIWYAGASPDDTNPNIDWGFVTSPQAGMNNREIHY
ARGKCLSGSSARNYMTYHCGTTDSYSKWATEVDDSSYELSNFWPYFQKTVNFTQPDNERR
AANASIPETDRFASGSPLQVSHPVYANPFSSWVKKALQYMGFKEAKDFVSGELSGVQYNM
VTVDPRWSTRSSAEEFVRSIGVADNFKIYNGTLAQKLVFKGTTATGVKVTTSGKDYTLSA
KKEVIVSAGAFQSPQLLMVSGVGPADILEEFDIPVISELAGVGQNMWDHLLFGLSYQVTT
PSHSAVGNAEYLAQATEEYLADGSGMLGNPGGDIVAWEKLAGKQLKRLSADTQCRLGDSF
PSDWPEVEYITLDAYMGNNQNYITGAPQTPYMYVSPAASLVSPFSRGNLTIASASMEDDP
IINPNWLTDTADQELAILAVKRIREMVDTDIMKNVIVGTEVYPGRDKVSTDAEILNFVRD
NGIQIFHAAATCKMGTSKDPLAVVDSQGRVFGTSQLRVVDASAFPFLPPGHPQATVYALA
EKIAADIIGK

Enzyme Prediction     

No EC number prediction in P170DRAFT_343506-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	37	608	5.1e-175	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	5.32e-96	34	610	2	534	choline dehydrogenase; Validated
225186	BetA	9.25e-84	35	608	5	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	5.22e-41	463	603	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.27e-32	12	610	34	583	Protein HOTHEAD
366272	GMC_oxred_N	1.35e-13	114	350	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA10037.1|AA3_2	1.99e-250	19	608	23	613
QSZ31585.1|AA3_2	1.05e-193	12	610	11	620
AUS76865.1|AA3_2	1.77e-187	3	608	4	611
ATZ50225.1|AA3_2	3.92e-186	13	607	17	608
QKX54324.1|AA3_2	1.22e-182	27	608	36	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	8.89e-61	37	610	5	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6YRU_AAA	2.52e-52	31	610	1	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
7AV4_AAA	3.10e-52	31	610	77	639	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	3.28e-52	31	610	17	579	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6ZH7_A	3.47e-52	38	610	8	563	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	9.91e-191	4	609	11	626	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	9.11e-189	27	609	42	626	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	4.18e-158	4	608	6	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	8.63e-152	35	610	38	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q12062|AFLK_ASPPU	3.29e-151	30	608	69	640	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.299412	0.700566	CS pos: 23-24. Pr: 0.3624

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_343506-t37_1-p1.