CAZyme Information: P170DRAFT_343458-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_343458-t37_1-p1
• CAZy Family: AA3
• CAZyme Description: glucose-methanol-choline oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
621	MSFO01000001|CGC25	66821.73	6.7734

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000001:2963167-2965140(-)

Full Sequence      

MYLAQAVSLITALALSAHAVPTDFHIKTRGLLGSSFGVPGKNATFDYVVVGGGTAGLTLA
TRLAEQQKGSVAVIEAGGFYEIDNSNISQIPALDGTYTGRSKSDWQPLIDWGYITTPQAG
SYEDELHYARGKCLGGSSARNYMVYQRGTTSSYKRWADMVGDASYRFEKFLPFFEKSIKF
TGPNMDLRFKNGSAEYDPHVMGDGSGPLSVTFSHYVQAFGTWATKGLQAIGIPIVPGFQS
GSLLGQSYSMFTINATTMVRDSSETSFLRKGLGHSNYMVYQSTMAKKIIFDKKKRATGVI
VDTDGLGYQLDARKEVILSAGAFGSPQLLLASGVGPASTLESLGIPVVADRPGVGQNMED
HIYFGPSYRVNAPTLSALGYPDFAAAAAKEFNENASGMYTNPTTDVIAWEKVPRNLRSHF
SNETLASLATYPADWPELEYLSLSAYLGYQANLATGDPHDGYNYASLSVAIVAPLSRGNL
TIASADTADQPIINPNWLTDPADMEVSIAGFKRVREFWNSKAMKPFVIGEEAFPGPHIKT
DAQIEDIIRKSFNTIYHAACTCAMGKKDNPMAVVDTKARVIGVKGLRVVDAAAFPVLPPG
HPQATVYALAEKIACAITGAC

Enzyme Prediction     

No EC number prediction in P170DRAFT_343458-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	44	617	6.1e-186	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.92e-104	41	619	2	533	choline dehydrogenase; Validated
225186	BetA	5.91e-97	42	617	5	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.13e-44	474	613	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	3.18e-40	34	606	45	565	Protein HOTHEAD
366272	GMC_oxred_N	6.70e-20	129	361	22	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07712.1|AA3_2	8.75e-265	12	619	15	627
QGA12464.1|AA3_2	8.38e-264	26	621	18	613
ATZ47873.1|AA3_2	5.45e-261	25	619	30	627
QSZ35459.1|AA3_2	1.95e-256	21	620	26	628
UJO24560.1|AA3_2	1.08e-225	18	614	91	685

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.16e-66	42	614	3	579	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	8.69e-64	45	612	2	556	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.71e-63	43	612	1	557	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
2JBV_A	1.56e-61	45	614	14	523	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.56e-61	45	614	14	523	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.99e-285	29	621	36	628	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	3.45e-274	29	621	37	628	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	5.55e-194	5	614	1	604	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q12062|AFLK_ASPPU	1.19e-171	23	614	52	636	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1
sp|A4UHS8|VBSA_DOTSE	5.43e-171	17	614	47	640	Versicolorin B synthase OS=Dothistroma septosporum OX=64363 GN=vbsA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001087	0.998883	CS pos: 19-20. Pr: 0.9608

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_343458-t37_1-p1.