CAZyme Information: P170DRAFT_270575-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_270575-t37_1-p1
• CAZy Family: AA3
• CAZyme Description: putative unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MSFO01000008|CGC8	41613.56	5.7983

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000008:697204-698304(+)

Full Sequence      

MASKPSPPQVREKVDLLINNLVNIKDATGQFLLRLQDGRVIDTKSWHGWEWTHGIGLYGI
WKYYEMTGNPDLLRIIEDWFAARFAEGGTTKNINTMAVFLTLAYVYEKTGNVTYLPWLDA
WAEWAMHDLPRTRYGGMQHATYLTENYQQLWDDTLMMTVLPLAKIGKLLNRPAYIEEAKR
QFLVHIKYLFDTRSGLFYHGWTFEDGGHNFADARWARGNSWITIVIPEIIELLDLQPSDP
LRIHLLDTLEAQCESLQRLQDPSGAWHTLLDHADSYAEASATAGFAYGILKAVRKRYLGP
QYREVAEKAITSVLGYVDAAGELQNTSFGTGMGDSLEFYKLIPLTAMPYGQAMAIMALGE
YLRGTL

Enzyme Prediction     

No EC number prediction in P170DRAFT_270575-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	42	363	4.9e-108	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	3.97e-109	20	363	7	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.69e-104	23	363	1	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE56723.1|GH105	1.92e-241	1	366	1	366
QMW46699.1|GH105	3.87e-241	1	366	1	366
QMW34630.1|GH105	3.87e-241	1	366	1	366
QRD93550.1|GH105	3.87e-241	1	366	1	366
UDD63587.1|GH105	3.87e-241	1	366	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.41e-169	9	363	7	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	1.67e-165	9	363	25	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.84e-164	20	363	37	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	3.18e-20	150	363	199	412	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.21e-51	49	363	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P9WF04|UH105_ALTSL	5.60e-12	151	313	201	365	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.61e-09	166	312	10	158	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.61e-09	166	312	10	158	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_270575-t37_1-p1.