CAZyme Information: P170DRAFT_183835-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_183835-t37_1-p1
• CAZy Family: AA11
• CAZyme Description: putative mannosyl-oligosaccharide glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821	MSFO01000004|CGC15	93124.77	4.5828

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000004:2425366-2428209(-)

Full Sequence      

MNRFNFYSLLFPLSWAVAVFAGQTATGDESILAKEAARANNQSLLWGPYKSNLYFGVRPR
IPDSISAGLLWAKVDDFATAQQNFRHTCEQNEGMAGYGWDEYDIRKGGRQTIHDAGNSLD
LTVDFVKVPGGEHGGSWAARVKGVPREDAPPDQPTTIVFYSALEGLGDLRVTTESEDPRG
FDGDVRLSGNTPDLGDFSIDVTAGPESNEHPEHDHPSYEDKPLDRTLVSSSTIQSEHVWQ
TKVILFSQMKGEVNEIIQKYGPDNPPPPPQVFSIKNIPGDGNIHLVQKVFKGEFEFDILF
SSGSSPQPLTSEKLTEEIASSSLSFADRFEKILPPQAPFNSKEYSEFSKSMLSNLVGGIG
YFHGTDVVDRSAAPEYDEENEGFWEETAEARARAHAVLEGPKQLFTSVPSRPFFPRGFLW
DEGFHLIPVLEWDTDLALEIVKSWLNLMDEDGWIAREQILGSEARSKVPPEFTVQYPHYA
NPPTLFIILEAFIDQLEVNKNISVDRSQEDLTETLGSVYTQHPELGEAYIRSIYPLLKRH
YFWYRNTQRGEVSSYDREAFSSKEAYRWRGRSIQHILTSGLDDYPRAQPPHPGELHVDLI
SWMGMMTRALRRIAETLGETEDVEELRVYETAIERNIEDLHWDNEAQTYCDATIDEFEES
VHVCHKGYISLFPFLTGMVGPDSPRLKAILDLIGDPEELWSDYGIRSLSKKDEFYGTAEN
YWRSPIWVNINYLVFKNLYDIATTAGPHQEQARELYSNLRKNVVENVFREWKATGFAWEQ
YNPETGQGQRTQHFTGWTSMVVKMMSMPDLPASKKSGHDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	594	805	1.4e-33	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	309	807	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	3.30e-126	44	264	1	218	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	8.08e-06	527	755	358	561	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD84190.1|GH63	0.0	8	821	4	817
UDD57712.1|GH63	0.0	8	821	4	817
QMW44709.1|GH63	0.0	8	821	4	829
QMW32679.1|GH63	0.0	8	821	4	829
BAE61889.1|GH63	0.0	8	821	17	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	3.72e-170	34	805	5	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.03e-138	44	806	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	2.22e-246	30	806	28	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	9.25e-170	8	805	6	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	3.59e-139	44	806	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	9.54e-135	46	806	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	2.69e-130	13	806	63	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.008802	0.991141	CS pos: 21-22. Pr: 0.9600

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_183835-t37_1-p1.