CAZyme Information: P170DRAFT_162373-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_162373-t37_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504	MSFO01000003|CGC31	55889.92	5.9153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000003:4045922-4047519(+)

Full Sequence      

MSCRNHEEPRLIPSSPPYSEGPLKLPFQRPAAECRTFSSPAVEQVIEDVTSRMKDKDLAQ
IFGNAFPNTLDTTVRWHVDGTSAASKNRRDSQWQGPQTFIVTGDINAEWLRDSTNQLTGY
QALAKKDKKLHSLILGAINTQAEFVIQSPYCNAFQPPPPSGLEPAKNGQDDQVHPAYEPS
VVFECKYELDSLAHFLALGTEFYESTKSTEFLTDRWYSALDTLLKVLDAQSQPTFNDKGQ
HVVNQYTFQRKTTLGTETLSLAGVGNPLNHGTGLIRSAFRPSDDATILGFFIPPNAQMAV
QLKKTAKVLRAAGGKADLAKDLEDRGDRLDKAIKEHGIVNHAKYGDVYAFEVDGYGSRIL
MDDANIPSLLSLPYLGYVSKDDKVYQNTRKMLLAKDGNPYYFTGSDFHGIGGPHIGLQNA
WPMSLLIQAMTSDSDAEITESINLVRNSSLLGLVHESINVNNIKDYSRPWFAWANSVFAQ
TILKVAAERPHLLFGEGAEPYIIE

Enzyme Prediction     

No EC number prediction in P170DRAFT_162373-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	55	483	5.4e-163	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	55	483	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	8.72e-163	34	493	2	430	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD90853.1|GH125	1.75e-315	16	504	47	537
QMW43832.1|GH125	1.75e-315	16	504	47	537
QMW31801.1|GH125	1.75e-315	16	504	47	537
UDD60757.1|GH125	1.75e-315	16	504	47	537
BAE61251.1|GH125	1.43e-314	16	504	47	537

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0V_A	1.30e-107	29	488	43	471	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	2.48e-106	29	488	23	451	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3P2C_A	6.56e-104	29	488	21	453	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	6.71e-82	42	482	12	419	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	3.70e-81	42	482	12	419	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	1.78e-187	21	493	43	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P170DRAFT_162373-t37_1-p1.