CAZyme Information: P170DRAFT_112203-t37_1-p1

Basic Information

• Species: Aspergillus steynii
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus steynii
• CAZyme ID: P170DRAFT_112203-t37_1-p1
• CAZy Family: AA1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MSFO01000002|CGC37	38338.81	9.3104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AsteyniiIBT23096	13430	1392250	235	13195

• Gene Location: location=MSFO01000002:3979555-3980695(+)

Full Sequence      

MLLTRVRLLLVVLLVFLLAFLQSALALQLYLLLRLPFVWRSSSADSIISLHRDLFDLSFH
SYPASPVPSDSESAGLSQFELLVPARLHHIHLGTAELRPEWQAARAECLKQHPDWEPFLW
DDVAARRLVREEFPELADLWENYPYLVQRVDALRYMVLYKYGGAILDFDLVCRRPLDPLR
RFEFVAPAAHPAGFSIGMMLAAPNHSFVGDLIHQLPAFNRRWLLLPYATVMFSAGCHYAS
TIYTTQRNRTGLRILSGPPTDPTMHMLNGLVDTPLFRHLGTSSWHAQDVAMFKLTLRGSW
TCLVAFGIGFGAVVLVSLGAFGVMRRSLKRARATITKTV

Enzyme Prediction     

No EC number prediction in P170DRAFT_112203-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	100	180	4.6e-18	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.72e-23	83	235	82	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.17e-15	100	183	3	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD88351.1|GT32	5.99e-131	4	339	4	334
UCK58105.1|GT32	1.85e-127	4	334	4	329
BCS05573.1|GT32	1.86e-125	5	333	5	321
BCS17124.1|GT32	1.86e-125	5	333	5	321
CAK44892.1|GT32	1.31e-124	5	314	5	306

PDB Hits     

P170DRAFT_112203-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	1.57e-32	82	315	54	281	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	6.88e-31	65	333	49	308	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	5.11e-30	82	315	61	289	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.36e-29	94	334	67	301	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.99e-25	80	291	79	288	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.167295	0.832686	CS pos: 26-27. Pr: 0.7951

TMHMM  Annotations     

Start	End
9	31
300	322