CAZyme Information: P168DRAFT_99581-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_99581-t37_1-p1
• CAZy Family: GT90
• CAZyme Description: FAD-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
486		52476.96	5.0664

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000002:2213697-2215157(+)

Full Sequence      

MAPIWTKAVALASLAAFAAAGDLQSCLDAATPKVAYEGDPLYQATAVKRYNLDIKVTPAA
VTFPQNAQEVAEVVRCASENGVAVQAKSGGHSYANHGLGGEDGAVVVDLKNLQRFSMDTQ
SWKASFGSGLLLGDVTKQLSENGGRAMSHGTCPQVGSGGHFTIGGLGPTSRQFGAALDHI
VEVEVVLANATIVRASENQNPDVFFAVKGAASGFAIVTEFVVRTEPEPGQAVQYAYSFTF
GDTESRAKLFKQWQAYVAQPDLTRKLASTLTLLEGSIFITGTFFGSKSEYEALKIEENFP
GANNASLIVFDKWLGLVAHWAEEVGLQIGGGIAANFYSKSRSFTEKSLMSPKDIDRLFEF
VDNTDKGTPLWFAIFDFQGGAINDVPQNATAFAHRDTLIWLQSYAINLLGEVKQETFDFL
DRFNEVTVAGNAASVPYEAYPGYVDARLEQPQQAYWGSNLDRLKKIKAAIDPDNVFRHPQ
SVHGAK

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	48	295	1.1e-69	0.5283842794759825

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	7.58e-30	55	482	29	456	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	4.08e-29	58	196	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	6.09e-14	439	482	1	44	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	3.63e-09	39	228	46	242	cytokinin dehydrogenase
273751	FAD_lactone_ox	3.66e-07	64	264	21	211	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00400.1|AA7	4.59e-179	23	486	10	476
CAE7010772.1|AA7	2.93e-171	23	482	13	475
QGA17347.1|AA7	1.46e-170	33	482	23	471
AHG26149.1|AA7	2.60e-168	23	482	6	467
CCA70426.1|AA7	1.30e-167	23	485	54	518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K8E_A	2.35e-65	3	486	5	496	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
1ZR6_A	1.08e-63	50	482	35	476	The crystal structure of an Acremonium strictum glucooligosaccharide oxidase reveals a novel flavinylation [Sarocladium strictum],2AXR_A Crystal structure of glucooligosaccharide oxidase from Acremonium strictum: a novel flavinylation of 6-S-cysteinyl, 8alpha-N1-histidyl FAD [Sarocladium strictum]
3HSU_A	2.21e-62	50	482	35	476	Chain A, Glucooligosaccharide oxidase [Sarocladium strictum]
6Y0R_AAA	7.12e-60	23	482	27	488	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
3RJ8_A	5.33e-56	21	486	1	473	Crystal structure of carbohydrate oxidase from Microdochium nivale [Microdochium nivale],3RJA_A Crystal structure of carbohydrate oxidase from Microdochium nivale in complex with substrate analogue [Microdochium nivale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B6HNK6|SORD_PENRW	2.16e-101	44	482	31	467	FAD-linked oxidoreductase sorD OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorD PE=3 SV=1
sp|G2QG48|XYLO_MYCTT	1.21e-64	3	486	5	496	Xylooligosaccharide oxidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=xylO PE=1 SV=1
sp|Q6PW77|GOOX_SARSR	5.09e-63	50	482	54	495	Glucooligosaccharide oxidase OS=Sarocladium strictum OX=5046 GN=gluO PE=1 SV=1
sp|I1S2K2|CHITO_GIBZE	3.66e-59	23	482	27	488	Chitooligosaccharide oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=chitO PE=1 SV=1
sp|I1SB12|MNCO_MICNN	2.26e-55	12	486	14	495	Carbohydrate oxidase OS=Microdochium nivale OX=5520 GN=MnCO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000247	0.999729	CS pos: 20-21. Pr: 0.8757

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_99581-t37_1-p1.