CAZyme Information: P168DRAFT_84329-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_84329-t37_1-p1
• CAZy Family: GT8
• CAZyme Description: beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
882	MSFM01000002|CGC3	96220.08	7.2182

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000002:79542-82252(-)

Full Sequence      

MYTNVSAAAEDATRLVLELQTIARNAGHLVPLLIALDQENGGVNSLYDDQYIRQYPSAMG
VAATGSKLLAREVAMATARELKAVGVNWILGPVLDVLTNVRSQPLGVRTTGDDPHEVSQY
GVEYLKGYQAGGLVTCGKHFPSYGNLEFLGSQNDVPTITESLEQLSLTALVPFRNAIIHG
LDSMMVGGVSMSSSGVNVMHACLSEQVVDDLLRKDLKFNGVVVSECLEMEALTHNIGVGG
GTVMAKNAGCDIVLLCRSFPVQQEAINGLKLGVENGIIGRARIEQSLHRILNLKAKCTSW
EQALSPQGLPSLTQMQPSHTNLSTKAYSSSVSVVRDKKNLLPLSNILEPHEELLLLTPLV
KPLPASAVSHQITEHLDSSLDPVVWDRTASVLSGESVFKELGRSLSRQRNGRVLHTSYTA
NGVRPIHENLIDRASAVIIVTADANRNMYQHGFTKHVSMICRSQFTATGEPCEKPMVVVA
VSSPYDFATDPTIGTYLCTYDFTETALEALVKVLYGECTPMGMLPGSISRSQKLHQARQH
WLVEHFNEERDTHALDRLLDMVREDCVQGKRSELQGVTPRSFFLRREEIDEAHFVVRNSS
TQAIYGFCSTYYFRSTGTGVIGSLIVDPTRRKLSIGTSLHNRAIRTLLQRKGMRRFQLGS
RLPGIYLGIPSANPVERKRLRQWFANLGWNTALSRPVCSVVLRNLQTWTPSGGLLQGLQN
TEVSYDLVYGWDYAESILDHVKTNSRQGVMDIYKLALGGAPGCGIIRAKRPTDGAILGSV
VVYNNRALLAEHMPALKATHASAGGISSPVISPSVGEYATVMQGLVLLGIKQVRKQGADA
VIMDCVDGDSNFDCLSGMGFHTLHSFEEVNCDAATWAMVPAP

Enzyme Prediction     

No EC number prediction in P168DRAFT_84329-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	254	7.6e-53	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.34e-62	18	344	48	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.14e-48	10	293	46	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	2.03e-27	31	289	56	308	beta-hexosaminidase; Provisional
178629	PLN03080	1.00e-09	55	525	114	585	Probable beta-xylosidase; Provisional
185053	PRK15098	8.47e-08	54	225	119	287	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK47105.1|GH3	0.0	8	882	233	1107
BCS15461.1|GH3	0.0	8	879	57	928
BCS03847.1|GH3	0.0	8	879	39	910
BAE65506.1|GH3	0.0	8	881	86	960
QRD92904.1|GH3	0.0	8	881	39	913

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	4.39e-78	1	689	44	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	1.26e-50	4	529	52	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	2.27e-35	13	528	99	617	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.23e-35	13	528	73	591	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.23e-35	13	528	103	621	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.17e-34	13	528	99	617	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	2.35e-34	9	525	67	552	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.89e-27	19	529	87	597	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q1H075|NAGZ_METFK	2.11e-22	31	288	58	316	Beta-hexosaminidase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) OX=265072 GN=nagZ PE=3 SV=1
sp|Q3SKU2|NAGZ_THIDA	3.31e-22	31	283	58	308	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_84329-t37_1-p1.