CAZyme Information: P168DRAFT_343243-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_343243-t37_1-p1
• CAZy Family: GT71
• CAZyme Description: fibronectin type III domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1011		110596.11	4.7305

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000006:379824-383403(+)

Full Sequence      

MHGKPWHGLAAIATFSSYALANPFGHWNMPGNASVDTERLMARDTTEFDQTDLSFIKRMA
ALGDSYSAGIGAGGRLGTIVGALDPSNWACSRYDHAYPYLVHTDDRLGDEDARTFQFMSC
SGAVISNVVNDQIPNISGDQQLILLSAGGNDVELSNILNQCIFQWAVFNPTQVNVAKTAA
LENSQYTWAKTFDWESIGRGCDGQLARTKQLIAADAFSKSLDSVISAAKKKLGSDYAKFF
AEDLSSACDSVSWSTWIYKSYNMFQDTQKLTKDHRKIMNDLVDAVNSKIVFKFVDYDPYV
GKFKGRFCESGVDESTVESNTRTGLMFYELNTWDPLGRNPWKRSQDNPLEGTFEGDMNIL
AQITLLMDPDAKLTDQALISGISADSLPTSDVVPFSTAAVPDVEIPNILPDGYGRVFHPQ
ILLHGLIAERVIYEIVNKNEQDNGFPAIPEKLTFDSCPNFPSSNSSNGQQIAVASYINPL
ADPAAWDRLINYPTKKMPILVANVVNGPDSAVDKTWADVIDRASASGKTVLGYVRTGYLG
VSAQKFTTRLGSGSLADWTAQIEEDIDMWYTLYGSSMGGIFFDEGWPECGDNDKYVDLYK
YINDYTKRAHPGAYTVLNPGSPMASCFEDTMDTLLTFELSYDAYMNSYTPNDWTAKDPRK
IWHIVYSVPESAVGKVTKLAKERGAGFIQLTDDTLPNPYDTLSGVSYVKSMMGGIKGGSL
LNNPASPWTSGSTAAAVSGLSASTSDYTSAKLSWDAASDALGYHVYLGDKLVASVPSSMT
AITIGGLGSGASHAFHVSAVGGGGHIGTSSNTVTVKTKSLPNGKTITKYHSSPGADSTTI
QADILVPYAFIRLYIWSSVGCEFDTDPGWSVNFKIDEYVCTHYMVEGTTLYKYSGTLPKG
STAPPWAWSEVGPITLDITKYTYTWTLPLGTSKIDTSKFVIQAQGYNPLTNVFEPDPSAY
DCKGSSMCTTPDLLKWCDHAVNTLQRYDDPFYHAVSEWVLFRFQSLLFLLC

Enzyme Prediction     

No EC number prediction in P168DRAFT_343243-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	472	703	1.2e-21	0.9535864978902954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	1.04e-47	476	711	1	238	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
238861	SEST_like	6.35e-26	57	311	1	224	SEST_like. A family of secreted SGNH-hydrolases similar to Streptomyces scabies esterase (SEST), a causal agent of the potato scab disease, which hydrolyzes a specific ester bond in suberin, a plant lipid. The tertiary fold of this enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles two of the three components of typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxylic acid.
238020	FN3	1.37e-06	736	817	3	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
406036	MU117	7.35e-04	961	993	1	31	Meiotically up-regulated gene family. This protein was identified as being up-regulated during meiosis in S.pombe. This family of proteins is found in largely in plants and fungi. Proteins in this family are typically between 128 and 920 amino acids in length.
238870	SGNH_hydrolase_like_1	0.001	58	152	1	80	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11365.1|GH0	0.0	1	986	1	1024
BCR99052.1|GH0	0.0	1	986	1	1024
UNO38501.1|CE3|GH0	1.26e-126	462	960	490	990
CCT67685.1|CE0	2.13e-123	11	464	9	463
QGI80975.1|CE0	2.15e-123	11	464	9	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HYQ_A	8.77e-13	61	177	7	110	Crystal structure of phospholipase A1 from Streptomyces albidoflavus NA297 [Streptomyces albidoflavus]
5MAL_A	6.77e-09	61	164	6	96	Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus],5MAL_B Crystal structure of extracelular lipase from Streptomyces rimosus at 1.7A resolution [Streptomyces rimosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9S2A5|LIP1_STRCO	4.97e-09	61	164	40	130	Lipase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO1725 PE=1 SV=1
sp|Q93MW7|LIP_STRRM	5.21e-08	61	164	40	130	Lipase OS=Streptomyces rimosus OX=1927 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000799	0.999187	CS pos: 21-22. Pr: 0.9647

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_343243-t37_1-p1.