CAZyme Information: P168DRAFT_342448-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_342448-t37_1-p1
• CAZy Family: GT69
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588		63493.63	6.7327

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000005:1163034-1164861(-)

Full Sequence      

MGENAEPARFLASRFDYIIVGGGTAGSVLAARLSEDATVKVGVLEAGKSRVGDAHVDSPW
GISQMLSNPEYDWALETTPQAGTNGRVHHLSGGKMLGGSSGINFMSYCRPSAADIDHWGR
GGIQGWTWGELAPYYSKAQCLEHDVSRRDDLGSIKTCLPKWDLPIEPAMIDALNTAAGTV
MPSDPWYGNHLGFYKSLSTLDYGTTSEATKQRCPTRSYAASGYLAPVMHRKNLQVLDEAT
VCRVSLVTEPTKAPRARWVHFWYRGSCHRILATREIILCAGSLHSPHLLELSGIGDPDVL
HTAGIPCQVALPDVGNNLREHPMASVTYHLQTPEDILPRGPTSHDRKQNTTACPFSLTGF
LPYTALAPADKIEHTIANARSGITDTDTATTRTTTHLLARLQDPESAAVQLIGYPRGLNL
GSQSPDRGSYSLLVIGSHPISHGSCHVQSGDPFAMPRIDPGILQESPDVDVLAAGVAFAD
QVFHSKHLVGRIAERAHPGPSIDFTDPNQAKEFVRQSAVAFNHSIGTCAMGYVVDDRLQV
KGVAGLRVVDASVIPLHIDGNPVSTVYALAERASDLIREESRRRLSTL

Enzyme Prediction     

No EC number prediction in P168DRAFT_342448-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	579	1.3e-140	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.38e-84	12	584	5	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.03e-83	14	578	5	532	choline dehydrogenase; Validated
274888	Rv0697	5.47e-47	16	578	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	3.96e-32	439	573	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	4.52e-20	83	322	14	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ47931.1|AA3_2	5.50e-161	3	580	2	617
UPX44764.1|AA3_2	5.50e-161	10	580	9	611
UBX54549.1|AA3_2	1.07e-160	10	580	9	610
ALI92648.1|AA3_2	1.10e-160	10	580	9	611
AMU19396.1|AA3_2	1.10e-160	10	580	9	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	1.32e-60	15	582	6	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	1.12e-56	15	580	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6ZH7_A	1.97e-56	11	577	4	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	5.02e-56	1	577	12	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
7AV4_AAA	6.98e-56	1	577	72	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.95e-161	10	580	9	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.95e-161	10	580	9	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	6.40e-151	13	577	12	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	1.21e-67	15	577	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	1.21e-67	15	577	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000029

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_342448-t37_1-p1.