CAZyme Information: P168DRAFT_324993-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_324993-t37_1-p1
• CAZy Family: GT32
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MSFM01000002|CGC10	54309.74	4.7775

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000002:2068176-2069874(+)

Full Sequence      

MGSTSTLPPDFLWGFATASYQIEGAVSEDGRGPSIWDTFCKVPGKIAGGATGDVACDSYH
RTHEDIALLKTCGAQAYRFSISWSRVIPLGGRNDPINQKGLQHYVKFVDDLLEAGIKPLV
TLFHWDLPDELDKRYGGLLNKEEFVADFARYARVVFDAMGDKVKYWITFNEPWCSSVLGY
NVGQFAPGHTSDRTKSAVGDGSREPWTVGHSLLVAHGAAVKIYRDEFKERDGGEIGITLN
GDWAEPWDPENPADVEACDRKIEFAISWFADPIYHGKYPDSMVKQLGDRLPTWSPEDIAL
VHGSNDFYGMNHYCANYIRARTGEPDPNDTAGNLEILLSNKKGEWVGPETQSPWLRPSAI
GFRKLLKWLSDRYGRPKIYVTENGTSLKGENDLPLDQLLEDEFRTQYFRDYIDAMADAYT
LDGVNVRAYMAWSLLDNFEWAEGYETRFGVTYVDYENDQKRIPKQSAKTIGEIFDRYIQK
A

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	474	7.6e-161	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	0.0	6	468	4	442	Glycosyl hydrolase family 1.
274539	BGL	2.31e-179	8	468	1	424	beta-galactosidase.
225343	BglB	1.18e-141	4	467	1	443	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	5.82e-109	3	467	26	473	beta-glucosidase
215435	PLN02814	5.33e-108	7	467	28	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD82378.1|GH1	0.0	3	481	5	483
QMW27934.1|GH1	0.0	3	481	5	483
UDD55888.1|GH1	0.0	3	481	5	483
QMW40005.1|GH1	0.0	3	481	5	483
BCS12207.1|GH1	0.0	1	480	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	2.37e-280	3	480	22	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	3.64e-241	7	480	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.10e-239	7	481	9	473	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]
5JBK_A	4.01e-238	7	480	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	8.01e-238	7	480	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	2.54e-191	7	478	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.50e-182	3	479	2	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q9SPP9|RG1_RAUSE	3.59e-142	3	480	18	517	Raucaffricine-O-beta-D-glucosidase OS=Rauvolfia serpentina OX=4060 GN=RG PE=1 SV=1
sp|Q7XKV4|BGL12_ORYSJ	3.70e-137	3	467	35	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	7.41e-137	3	467	35	501	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_324993-t37_1-p1.