CAZyme Information: P168DRAFT_324789-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_324789-t37_1-p1
• CAZy Family: GT32
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352	MSFM01000002|CGC8	37780.76	7.6975

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000002:1363473-1364591(+)

Full Sequence      

MKCIILLLAVLLLSIQATALPRVVARDGPFDIVIALVDEAGNPIKYVTDAANGILSQFQP
KPKPDPKPAPKPDPKPAPKPDPKPEETKPNTEARVPHGISYSPYNADGTCKSQSQVNADI
ARIQPQYAFVRIYGVDCDQTHTVTTAARKHNMQVFAGIYDLQDYSSSLQTLIKAASSDWS
TIHTISIGNELVNRGQATPQQMVQALQQARDTLRPAGYKGPIVTVDTFSMLLAHPELCTA
SDYCAANCHAFFDATQSAAGAGAYVAGKAGEISRKAGGKRVVITESGWPHAGQANGKAVP
SVENNRAAVQSLRESFRGNPADLVLFSAFDDAWKKDGEGTFGAERFWGIHGL

Enzyme Prediction     

No EC number prediction in P168DRAFT_324789-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	105	349	3.5e-25	0.932475884244373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	4.34e-68	96	349	45	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	7.44e-08	275	349	221	296	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW24913.1|GH17	7.33e-110	1	349	1	323
QMW36913.1|GH17	7.33e-110	1	349	1	323
QRD89175.1|GH17	3.27e-109	1	349	1	326
UCK57248.1|GH17	3.27e-109	1	349	1	326
QQK46021.1|GH17	1.02e-108	33	351	43	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4.45e-14	97	342	38	280	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.73e-13	97	342	38	280	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59XX2|MP65_CANAL	3.63e-67	98	350	128	376	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|P53334|SCW4_YEAST	4.03e-61	98	349	135	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	7.30e-59	98	349	138	385	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q4WC60|BTGE_ASPFU	9.66e-41	98	348	310	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|B0Y9Q9|BTGE_ASPFC	9.66e-41	98	348	310	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000208	0.999758	CS pos: 19-20. Pr: 0.9572

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_324789-t37_1-p1.