CAZyme Information: P168DRAFT_324613-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_324613-t37_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		50540.02	6.5769

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000002:825035-826438(-)

Full Sequence      

MRWQQPQPSTWARFLGTGALVSLAIITFLVFEGRFSNDVTKYALKSSMIPPPKDGSFGRC
ANGTEKWEFVAGRDANNHGLSEEQCLAAFPKLFVEADKSVEGRKANLVKYEELDELVMED
GMFRALIYNGELYVVDYADMTYTQTRAKSTLSSLNRALQAVPDRHNIPNVEFVLSSDDFS
NGKGPVWSYSKRDEDSTVWLMPDFGYWSWPEVKVGPYKEIRRRIAAVDDGEVAPDGSVTP
GMSFQDKRKQLLWRGSVNTNHEIRGKLLKAVQGQSWGSVRVIDWDEENDVRFNLLPMEEH
CRYMFLAHTEGRSFSGRGKYLLNCRSVVVSHKLVWREAHHAALIASGPDANFVEVERDFS
DLHTKLEFLIDNPEAAERIANNTVRTFRDRYLTPAAESCYWRYLVRRYASACEFEPVLYH
ADKDGKRQMRGTPFESWILSGH

Enzyme Prediction     

No EC number prediction in P168DRAFT_324613-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	169	411	1.1e-27	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	8.88e-25	123	416	39	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	2.90e-22	167	415	2	256	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD61446.1|GT0	1.94e-225	1	439	1	436
BCS13796.1|GT0	4.99e-222	13	441	12	441
BCS02108.1|GT0	4.99e-222	13	441	12	441
QMW29784.1|GT0	1.11e-220	1	439	1	458
QMW41857.1|GT0	4.51e-220	1	439	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	1.20e-08	167	415	128	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	3.71e-11	117	415	90	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	1.15e-09	162	415	132	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	6.35e-08	167	415	140	394	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|Q29AU6|RUMI_DROPS	8.38e-08	167	415	138	392	O-glucosyltransferase rumi OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=rumi PE=3 SV=1
sp|G3V9D0|PGLT1_RAT	1.88e-07	158	409	119	367	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000001	0.000001

TMHMM  Annotations     

Start	End
9	31