CAZyme Information: P168DRAFT_323711-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_323711-t37_1-p1
• CAZy Family: GT31
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
966	MSFM01000001|CGC14	103328.72	5.2461

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000001:2625769-2628725(-)

Full Sequence      

MLLLVQCLVLLGLVNAVPTPQDLQVEPKLDVARAASDYWVGNIKRQGAVAFGNGTDYQVY
RNVKDFGAKGDGVTDDTAAINKAISSGNRCGKGCDSATVTPALVYFPAGTYRVSKPVVQY
YYTQMVGDATSLPVIKATKNFAGMAVIDADPYEDDGSNWYTNQNNFFRAVRNFVVDLTDM
PQGSGAGIHWQVGQATSLQNIRFEMVKGGGDANKQQGIFMDNGSGGFMSDLTFNGGNYGM
FLGNQQFTTRNLVFNDCNTAIFMNWNWAWTFKSLSINNCHTGLNMSNSPQNQTVGSVLIL
DSKLTNTPTGVVTAFTKDSIPVGGGVLILDNVDFGGSKVAVAGADGKAVLEGGQVVSHWV
QGNSYLPSGAHKRELQAENTDQEVEVVVETVTETIMACSAEHHAPTLTTAPSSNAEPSST
AESRQGTADNNIPVPGMSVIYPTVGTLSAPGFAPHPSDGTGKATAEPPTDTKAPNVPGFH
PPAPKPTHETPAELSPVEPSAPVEHPTAVKPTAEAPPPHTGKPPAQSTAQPPMEGAPSTS
VVNAPAKPPHGSKTCSSKTVTKTRLQTILPAQTKPKSLLTGGKVFERSKPLYDEYAASSF
LSVKSGGAKGDGRSDDTAAIQKVLDSAKPDQIVYFDHGAYVITDTVRVPKNIKITGEIWP
LLMAHGENFGDEKNPIPMLQVGQVGDVGSVEISDLALQTKGPAPGAILMEWNVAEAKQGS
AAMWDTHFRVGGSAGTELQSDTCSKTPKQTTKPDPACVGAFMLFRLTEKGTAYIENAWYW
TADHELDLPDHNQINIYNGRGVLIESQGPVWLYGTASEHNQLYNYQIANAKNVFMGLIQS
ETPYYQANPDALTPFTPQKKWNDPDFASCTTAACRKAWGLRVINSSDVYVYGAGLYSFFE
NYGQSCLNSETCQENIVEVDCSDVHIYGLSTKASVNMITSSDGKSLVPEKDNTSNFCSTI
ALFKQS

Enzyme Prediction     

EC	3.2.1.58:16	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	557	963	5.1e-176	0.5391891891891892
GH55	32	382	1.1e-142	0.47162162162162163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	1.95e-101	60	284	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
223021	PHA03247	2.85e-09	404	575	2759	2931	large tegument protein UL36; Provisional
185616	PTZ00436	3.43e-09	416	583	192	356	60S ribosomal protein L19-like protein; Provisional
403800	Pectate_lyase_3	1.28e-08	600	657	1	61	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
282904	Herpes_BLLF1	7.99e-08	403	578	453	651	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW47168.1|GH55	0.0	1	966	9	950
QRD91479.1|GH55	0.0	1	966	9	950
QMW35104.1|GH55	0.0	1	966	9	950
BAE64877.1|GH55	0.0	1	966	9	950
UDD64170.1|GH55	0.0	1	966	9	950

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.21e-289	34	966	2	756	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.59e-188	32	966	20	758	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]
7CHU_A	1.68e-08	62	138	76	150	Chain A, Putative pectin lyase [Geobacillus virus E2],7CHU_B Chain B, Putative pectin lyase [Geobacillus virus E2],7CHU_C Chain C, Putative pectin lyase [Geobacillus virus E2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	0.0	8	965	16	875	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	8.91e-165	29	960	35	781	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	9.74e-50	568	943	354	737	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1
sp|Q44494|ALGE1_AZOVI	7.72e-06	62	114	4	47	Mannuronan C5-epimerase AlgE1 OS=Azotobacter vinelandii OX=354 GN=algE1 PE=1 SV=1
sp|Q9ZFG9|ALGE7_AZOVI	8.99e-06	62	114	4	47	Alginate lyase 7 OS=Azotobacter vinelandii OX=354 GN=algE7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999802	CS pos: 16-17. Pr: 0.9836

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_323711-t37_1-p1.