CAZyme Information: P168DRAFT_322566-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_322566-t37_1-p1
• CAZy Family: GT25
• CAZyme Description: ferulic acid esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295		32092.19	5.0732

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000016:319755-320720(+)

Full Sequence      

MKISTLLLANPAFITATVFAATLRPVPDFGDNPGNNQMLIYVPDQLAPNPAVIVALHGCL
EPALTYYLEVKDLPPASDKHGFIIIYPDTQKDSHCWDVATNKSLTHNKGSDSLSIVSMVK
YAIAKYNADPSKVFAIGSSSGAMMSQVLAAAYPDVFSAVSAYSGLPYGCLRGSPGSSPFT
SDPACSKGEVRKSGVEWATEVRSAWPGYNGSYPPVQIWHGTADQVLDPQNLQEEIKQWTT
VFEVQLTQKRKDDPSDGYTRSIYGDGTQFESYLAEGVGHVVPTQVQETLRWFGLF

Enzyme Prediction     

No EC number prediction in P168DRAFT_322566-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	37	237	3.8e-23	0.7929515418502202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.29e-36	38	242	1	198	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	8.42e-26	6	286	12	281	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.10e-21	40	237	5	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
223477	YpfH	2.89e-05	110	237	78	170	Predicted esterase [General function prediction only].
395257	Peptidase_S9	3.11e-05	119	230	52	162	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17501.1|CE1	4.29e-137	1	294	1	291
BAP90855.1|CBM1|CE1	4.40e-101	12	294	10	291
AXF48686.1|CBM1|CE1	4.40e-101	12	294	10	291
CAC14144.1|CBM1|CE1	1.56e-100	12	294	10	291
QGA17423.1|CBM1|CE1	1.72e-100	12	294	10	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	3.91e-70	20	293	1	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8M9H9|FAEB_TALSN	4.97e-103	12	294	10	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	2.77e-101	12	294	10	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|G2QND5|FAEB_MYCTT	5.47e-89	12	294	10	290	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|Q9HGR3|FAEB_NEUCR	7.42e-87	12	294	10	290	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|B8NBI2|AXE1_ASPFN	3.32e-70	20	293	32	304	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000544	0.999423	CS pos: 20-21. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_322566-t37_1-p1.