CAZyme Information: P168DRAFT_322102-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_322102-t37_1-p1
• CAZy Family: GT22
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
632	MSFM01000014|CGC1	71474.21	9.7759

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000014:270586-272681(+)

Full Sequence      

MSSSQTVTATRIEKSGCCEDHGPYQIERIPYLGTFPLDSPVVVGAHILTWVLYFAYLAWR
VRFTWSLPVPNDSVWRFLWLNILIEMMTLVPEFVSRMEISLHVAFGRKPVHRDSYHLRGE
DAPSVDVYITCCGEDLDVIMDTVAGAASQDYPRDSFRVFLLDDAKCPEVQGAVERFNRKR
ARNFQRVIYLARTKTPGIPHNYKAGNIRFGLAEGARRNGGAEYIAALDADMIPVKDWLRR
IVPHLLLDKQVAMAVPPQRFYNTPDDDVLAQDSKVFSRLTEPINDSLGGTSCTGSGYVLR
RSALDSIGGWPLQNAAEDIVCAWMLTGQGWHIAFVKDEVQFGLAPGSLAALFKQRARWTD
GNILAYQRLGWFLSGADLRSQRTMLQRIICLCHVVKTYMAIPNSVMVMLIPWVLSPVEWP
KHMAPTTPRRTMHQMYLVLLIATLLQKWCFIGMHEHVSIKAAKRLQATKFWNMPLNVARI
VRSWIPGNAVGFDITGTVVSSINERSESHRKPIWVRLLNPTVLMYAGWIVYALVPLAFRL
RVYAAGESRHLVSPSPAAVVFFFSAIMKLSIPVQYMARPPTVPDRRRLLNKGPDGVYRVS
ESRKTDSLVQSKVSWKDVAEISIILLVGWRGF

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	223	414	1.6e-17	0.9086294416243654

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	6.14e-76	123	363	1	231	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
224136	BcsA	5.64e-32	75	503	1	420	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.69e-25	123	361	260	487	cellulose synthase catalytic subunit; Provisional
133059	CESA_CaSu_A2	8.76e-24	123	361	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.
133057	CESA_NdvC_like	1.68e-19	127	363	2	229	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64665.1|GT2	1.61e-96	53	593	189	733
QKX54251.1|GT2	2.95e-95	52	591	183	726
ATY58636.1|GT2	3.11e-95	47	604	192	758
QUC17541.1|GT2	1.09e-94	52	593	195	742
XP_748682.1|GT2|2.4.1.-	2.22e-94	52	593	138	683

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.95e-23	123	379	273	517	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	1.65e-19	117	361	122	374	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.82e-19	117	361	134	386	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.82e-19	117	361	135	387	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O82859|BCSA2_KOMSB	2.26e-25	56	405	89	417	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	1.63e-24	56	405	89	415	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|P0CW87|ACSA1_KOMXY	8.42e-24	47	367	80	382	Cellulose synthase 1 OS=Komagataeibacter xylinus OX=28448 GN=acsAB PE=1 SV=1
sp|Q9RBJ2|BCSA4_KOMXY	2.56e-23	41	384	71	395	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
sp|Q9WX75|BCSA5_KOMXY	2.56e-23	41	384	71	395	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000006

TMHMM  Annotations     

Start	End
40	59
390	412
432	454
513	535
555	577