CAZyme Information: P168DRAFT_320035-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_320035-t37_1-p1
• CAZy Family: GT2
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		60654.27	6.4032

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000009:234828-236523(-)

Full Sequence      

MMNSSFLPTIVEELPASRRQFDYIIIGGGTAGCVIAARLAESLPDATILMIEGGESELGK
ESILNLNGAADLWGSEAYDYAYNSVPQPYGNSNIIHSRAKMLGGCSSHNGAISFAPLAYD
CKRWQDLGAEGWTHAEMLRLMHKLRNNIIPVDERHRSQLVKDWLQTCSNLFGVPYIEDFN
REIETRGNLTQGCGFLSIAYTPGDNHRSSASVAYIHPILRGEVKRPNLTILQNTWVSRIL
FQGATATGAVATTHAGEEYSLTATTEVVLCAGAIDTPRLMLLSGLGPRQQLAKHGIPLVH
DIPGVGENLQDHAETMYMWELNDAVPPEQISMGSEGVMVLRREEFNARGEDNGVMDTLFH
MFTVPFDTYTKPMGYETPKNAFCVIPYTPRPASVGRLWLKSANPKEKPALDQRYFSDREG
YDKASNLFMLKMTRRMAQAEPFKKYLKREIAPGVHIVSDEDLCEYGRKVHNTVYHPCGTA
KMGNVETDRMAVVDPSLKVRGVKHLRVADASVFPCMTSINPMVTVLSIGERAAELIIEDA
GRAERAVL

Enzyme Prediction     

No EC number prediction in P168DRAFT_320035-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	14	544	5.9e-93	0.5210355987055016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.26e-102	16	543	3	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.33e-97	19	543	4	535	choline dehydrogenase; Validated
398739	GMC_oxred_C	7.63e-34	391	532	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.90e-23	21	543	56	584	Protein HOTHEAD
366272	GMC_oxred_N	4.67e-19	21	312	1	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD61121.1|AA3_2	3.49e-271	9	545	2	536
BCS15458.1|AA3_2	3.48e-219	12	541	5	534
CAK47101.1|AA3_2	1.41e-218	12	541	5	534
BCS03844.1|AA3_2	1.91e-218	2	541	84	623
EAA64559.1|AA3_2	8.07e-218	13	541	6	534

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	2.00e-102	11	536	6	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	2.00e-102	11	536	6	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	7.86e-102	11	536	6	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
4YNT_A	6.02e-49	21	540	6	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	3.95e-44	20	539	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	1.03e-101	11	536	6	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	3.25e-67	20	537	1	528	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q8BJ64|CHDH_MOUSE	6.10e-66	20	536	42	573	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	4.29e-65	17	536	37	571	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8G1Z8|BETA_BRUSU	3.33e-64	20	537	2	526	Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999881	0.000136

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_320035-t37_1-p1.