CAZyme Information: P168DRAFT_319648-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_319648-t37_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
281	MSFM01000008|CGC7	30159.72	4.7864

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000008:633801-634646(-)

Full Sequence      

MVAITRIVATALAATSALALPHGTSHSHTQTRSVTAGKRSTANKKGAAYNDASMVKSLAG
GSGNASKISWAYDWNMHSMGILPSDVEFVPMLWGSKMFGEWFNTIQTVLFSGSNYIMGFN
EPDVPSQAAMSPSEAAEHYKKYISPFNGKAKLVTPAVSSTEGDNAGLGWMRQFLDQCNDC
GMSVLAVHWYGDDAAAFKDFVSRAEALASSYNLEETWVTEFALNSDLSAGGGNEQSKEFL
GEVIPWLDSEPGVGRYAYFMCADGYLLSGEQLSTSGQAYLG

Enzyme Prediction     

No EC number prediction in P168DRAFT_319648-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	64	279	1.6e-64	0.9732142857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	5.20e-87	48	279	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE57006.1|GH128	2.99e-120	1	279	1	271
QMW39356.1|GH128	2.99e-120	1	279	1	271
UDD55125.1|GH128	2.99e-120	1	279	1	271
BCS23989.1|GH128	2.64e-118	8	279	7	269
QRD81657.1|GH128	8.07e-118	38	279	33	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	3.17e-54	44	279	4	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	7.88e-54	44	279	35	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UAX_A	2.51e-20	37	280	88	343	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UB7_A	1.71e-17	64	259	52	249	Chain A, Glyco_hydro_cc domain-containing protein [Cryptococcus neoformans]
6UAW_A	1.86e-15	27	280	19	276	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Pseudomonas viridiflava (PvGH128_II) in complex with laminaritriose [Pseudomonas viridiflava]

Swiss-Prot Hits     

P168DRAFT_319648-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000999	0.998949	CS pos: 19-20. Pr: 0.9567

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_319648-t37_1-p1.