CAZyme Information: P168DRAFT_313774-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_313774-t37_1-p1
• CAZy Family: GT1
• CAZyme Description: glycoside hydrolase family 65 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
890		98295.54	5.9156

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000021:17939-20819(+)

Full Sequence      

MLCTDSFLPNHYQTAPYVSNGYFGQTLPSEGMGYWVQRGENGSFTNNSWPLDQPRATFGT
VSGFWNLQENTTHFASPENLRRGGESVISGIPDWTGLLLTTADGNIYRPGVDSSTVRRYR
QCMSAQNGIVQTNVTWQPPSNTAFHLNYTILAHRTRATLGLVRLDIAVHDDTTVQVTDLL
DGAGAVRSEFESKGFDRGDSIWTSVKPYGISNVTAHIFSTIRFDGVNPDPISTKIGNPPR
VSTNASTIAQQWKVDLKRGDQVTIYKFVGIASSDAFGQSASLIARSSALQARSIPWNLLL
REHTNAWDQTWNDSDIIIPENVELQRAARASLFQILTNLPNTIELANSIHVGGLTSDSYA
GLVFWDADTWIYPAIQALHPQSAVTILKYRSRLLGQAIDNAKLYGYAGALYPWTSGRFGN
CTGTGMCKDYQYHLNTDIAQSLWNYFLQSNNLTWLAETAYPVIKGVADMFAAYVKKNQTT
GKYETILLGEPDEFAYFKDNGAFTNAGIAQLLGEWAPTAARLLNQSVPKNWSQIVQNIEM
PLNDQKDITLGFTGMPGDWVVKQASYSATTTPGGPAMTWSVFAISEAQIETQGCAAYTYL
LRSYEPYIRKPFYQFSETALDSMSEDNPAFPFGFNPAFPFLTGAGGFLQIFTHGLTGMRL
HSEYLHFDPVLPPQLPHGVVVKGLKWRGATLDVTISLNDSVISRRLSAEDSNERVLIQIG
KSDQTLELLPGQSITLPTRRPDLKSKNLAACTSVSSTSEFVSQMYPLSMVDGSNSTYWQP
TDTVASVIIDLGQPQNVSGVNLIWGPNPPRSFDLGIKVIENNDFIRLSTDGAVSISSPYR
PKEAELVRIRQPNITINRFENVYPVRYINLTVKGSWAAGQSATVAELDVF

Enzyme Prediction     

EC	3.2.1.28:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	329	561	2e-58	0.6532258064516129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224471	ATH1	3.34e-78	26	728	28	762	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
397616	Glyco_hydro_65N	4.38e-28	4	273	2	240	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.
237517	PRK13807	4.13e-24	159	548	148	549	maltose phosphorylase; Provisional
281612	Glyco_hydro_65m	2.72e-23	329	592	1	284	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
395611	F5_F8_type_C	1.53e-04	753	887	1	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ95901.1|GH65	0.0	1	889	27	960
UKZ52828.1|CBM32|GH65	0.0	1	851	25	919
QKX54508.1|CBM32|GH65	0.0	1	889	56	987
UKZ69511.1|CBM32|GH65	0.0	1	889	27	914
UKZ78628.1|CBM32|GH65	1.57e-285	1	851	25	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	2.28e-38	45	662	33	644	Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	1.41e-24	248	575	226	581	Crystal structure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	5.75e-21	307	554	277	549	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	1.32e-20	307	554	277	549	Chain A, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78617|TREA_EMENI	2.42e-138	1	886	65	1033	Acid trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treA PE=3 SV=1
sp|D4B5H9|ATC1_ARTBC	3.54e-137	2	847	69	976	Cell wall acid trehalase ARB_03719 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03719 PE=1 SV=1
sp|M1RNJ8|ATH1_CANGB	2.87e-130	6	816	173	1057	Periplasmic/secreted acid trehalase ATH1 OS=Candida glabrata OX=5478 GN=ATH1 PE=1 SV=1
sp|Q5AAU5|ATC1_CANAL	1.66e-126	10	810	119	960	Cell wall acid trehalase ATC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ATC1 PE=1 SV=2
sp|P48016|ATH1_YEAST	4.13e-123	1	816	132	1036	Periplasmic acid trehalase ATH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ATH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999816	0.000228

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_313774-t37_1-p1.