CAZyme Information: P168DRAFT_309943-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_309943-t37_1-p1
• CAZy Family: GH76
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MSFM01000004|CGC7	44437.48	4.9296

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000004:1139864-1141649(-)

Full Sequence      

MQVASLFATLLGFASASIIQNGQLRENPYPGQTPAIALDESWRTYAADAVEIGYKGRWDS
KHISWWSAPGAKFDFTGNQVALGFGPQTSEGVLVAYRIAGLDWEFSNVTADSVHQFVGPE
TGVAAEQTTFELRVTNWAYGVQLNNVSVGVDAQLRKSPEFGKNVEIIGDSLASGQYGTYE
GLSSWAFAFAAGLGNVEYSITAYPGICLQDKECYDNARGMTYQWNQASDCGARAKKVYGT
SPEKWNVSDHRAADLVVINLGTNDHRKGNEVAPEDFYDSYVKLIEEVHEAWPQANIIIMS
LWGTFDSKKDTYVQVPLYVRALKRVFERFRESGFVHYFDTTGILHHNDVNPKDHPTDVGH
IKIASHLMQFVKLRLGWEFAASGPEVEHDTLYWNDEAGY

Enzyme Prediction     

No EC number prediction in P168DRAFT_309943-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	165	371	4.5e-22	0.9856459330143541

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	5.85e-43	164	372	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
238141	SGNH_hydrolase	6.15e-18	164	370	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.87e-15	166	360	1	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	6.77e-07	248	367	74	224	GDSL-like Lipase/Acylhydrolase.
238872	SGNH_hydrolase_like_2	2.17e-05	161	364	1	185	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW34907.1|CE0	7.61e-176	14	399	14	398
QMW46983.1|CE0	7.61e-176	14	399	14	398
QRD91240.1|CE0	7.61e-176	14	399	14	398
QQK40140.1|CE0	7.93e-161	1	399	1	407
BCS11519.1|CE0	7.21e-159	66	399	39	368

PDB Hits     

P168DRAFT_309943-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P168DRAFT_309943-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000340	0.999622	CS pos: 16-17. Pr: 0.9295

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_309943-t37_1-p1.