CAZyme Information: P168DRAFT_307448-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_307448-t37_1-p1
• CAZy Family: GH72
• CAZyme Description: DUF1680-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633		70043.91	4.3924

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000014:367972-370335(-)

Full Sequence      

MFRWLLACLLVRSTLCAVEPFPLNKVSIAEGRFYENQDRTLSYLKFIDPERLLYNFRATH
QLDTKGATALGGWDAPDFPFRSHVQGHFLSAWAQCYATLGDEDCRDRAVYVVAELARCQA
NNEAAGFTEGYLSGFPESDIIDLEQGKLEGGNVPYYCLHKTLAGLLDVWRLIGDETARDV
LLAFAGWVDTRTAALDAPTMQTVLDTEFGGMNDILAALHDETDDARWLDVARRFDHAAIF
DPLAENRDELDGLHANTQIPKWIGALSEYHASGDDRYLDIAQHAWDITVSAHTYAIGANS
QSEHFHAPNAIAKYLNNDTAEACNSYNMLKLTRALWALDPHNATYFDYYESVLLNHLLGQ
QNPADPHGHITYFTSLNPGGVRGIGPAWGGGTWSTDHDSFWCCQGTALEVNTKFSDSIYF
SEESTLYVNQFIASELNWAEQNVHITQATSFPTEDSTTLTIQALPGSSSRRRAAASEFEL
YIRIPSWTTNPTITLNGEPLEDSLTPGQYAVIPARTWQPDDTVEVSTPMALRTIPANDDP
ALMAVAYGPTVLCGNYGEATLEGAPALQLDTLTQDASGELAFVGQADGQEVKLGPCYDAQ
GFGNTPASCAQYRVRIHQLCWFILHTSSQMQSW

Enzyme Prediction     

No EC number prediction in P168DRAFT_307448-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	26	552	1.4e-190	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400342	Glyco_hydro_127	9.14e-164	26	553	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
226063	COG3533	3.86e-106	23	557	9	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP91894.1|GH146	3.20e-270	21	602	42	612
QLQ36379.1|CBM13|GH146	1.02e-265	21	605	55	629
ADU11285.1|CBM13|GH146	3.20e-264	21	605	55	629
AYF28204.1|CBM13|GH146	4.54e-264	21	605	55	629
AXH92118.1|CBM13|GH146	4.54e-264	21	605	55	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	4.62e-91	18	563	25	570	Chain AAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.67e-86	18	563	25	570	Beta-L-arabinofuranosidase [Bacteroides thetaiotaomicron]
4QJY_A	5.13e-10	227	553	242	560	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.67e-09	227	553	242	560	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

P168DRAFT_307448-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000328	0.999648	CS pos: 16-17. Pr: 0.9504

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_307448-t37_1-p1.