CAZyme Information: P168DRAFT_305956-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_305956-t37_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
415	MSFM01000009|CGC8	46854.74	7.6292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000009:977464-978794(+)

Full Sequence      

MYPRRRRRLLPRLLWLISSVVLYFLIFGLPSPPPTTNNNRADKKAPDYDVESTPRYLYRS
SFRSDPDLSYEKNVSDALVAIETAVRQARKGDDTAQQHIWQIHLGRHKSQRGQDSLLFQQ
VNRDQWDYSLVTTLYAKTFINTVFASVPELQTLYKSYPHHVLRADLLRYLLLWYYGGFYA
DTDAFPARPIANCPALLPFFDANDTPQAHSLVLGVEIDEPHASAQLKRDWHWSRSYGFGQ
YTMFAPRRFSPILREAIVRVLSHTRQHRQRHGGVLGAEPAYDESTILEVTGPGVFTDAVI
DVLSRTLAPTHWLVQRSVAADEGIGDLAGEEGGSGSRRVTWAPFHEMRDPLCVGEGEGEG
EGADGGHGGLCVLPVSVWGNGQRHSSAEGFGSAQACVNHRFGRVWKKGWWEYLFG

Enzyme Prediction     

No EC number prediction in P168DRAFT_305956-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	121	193	1.1e-16	0.8111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398274	Gly_transf_sug	0.002	127	195	17	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS21634.1|GT32	1.32e-150	41	415	44	414
CAP98643.1|GT32	4.78e-150	40	415	47	421
QMW37982.1|GT32	4.82e-148	42	415	47	413
UCK58385.1|GT32	4.82e-148	42	415	47	413
QMW25899.1|GT32	1.37e-147	42	415	47	413

PDB Hits     

P168DRAFT_305956-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5A4E3|OCH1_CANAL	8.57e-15	116	406	121	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	1.27e-13	99	355	134	352	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	4.07e-12	126	407	132	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q9UTR6|OCH1_SCHPO	1.32e-11	118	406	164	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000002

TMHMM  Annotations     

Start	End
13	30