CAZyme Information: P168DRAFT_302134-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_302134-t37_1-p1
• CAZy Family: GH55|GH55
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
588	MSFM01000002|CGC12	67494.96	8.9066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000002:765578-768079(+)

Full Sequence      

MSSGSPSPRPDGGRGWSTPSLTPHSGRSTPRSSELLTPASVSSNISWASAKAKSEEVRGY
PSFATRNNGFFSRSKRQISATLPRWRSPSGYDDYAEKDEKGVYPYYGAGRRGCSPFGSGR
SVLRRKRMRLFVVMLLGLIGYLYMWSALVERYRRSPFGNGRKFVIVLESNIEGGVMELKG
AREWAVERNSIANKAAYAKRWGYDLEVVNMLAKKRYSHEWREGWEKVDIIRETMGKYPHA
EWFWWIDLNTWVMEESYSLQDHLFNRLSDITYRDINVYNPLNISHPPTEPYLDEVSRSAT
GDGDVSSINMVLTQDCGGFNLGSFFLRRSLWSERLLDSWWDPILYEQKHMQWEHKEQDAL
ENLYISQPWVRSSTAFLPQRYANAFPPGACGAGGDPEVHYSEAERDFVVNMAGCKFGRDC
WAEMHEYRELSKKLNRTWWEQVVMPSSYTSRSTTAARSTQFHHTLDPTLTSPYLNRNAQG
GGNERTKMPTPESASFLAKKPTVAPTYDGVDFEDNVAVHNARDAIIREQWVRSMMSRLVG
EELGKCYHREGVNHMEKCGVLREKYFELLSERKIKGYLGQEKNVFEKA

Enzyme Prediction     

No EC number prediction in P168DRAFT_302134-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	162	422	1.7e-81	0.983739837398374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	1.26e-75	162	420	4	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215617	PLN03182	2.82e-06	190	339	152	265	xyloglucan 6-xylosyltransferase; Provisional
215616	PLN03181	1.01e-04	193	339	156	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD89754.1|GT34	3.35e-222	5	442	6	442
QMW42907.1|GT34	3.35e-222	5	442	6	442
QMW30853.1|GT34	3.35e-222	5	442	6	442
UDD59694.1|GT34	3.35e-222	5	442	6	442
BCS30088.1|GT34	1.18e-218	5	442	6	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GCS_d	2.63e-12	506	583	11	88	Chain d, NIDM SUBUNIT [Yarrowia lipolytica],6RFQ_d Chain d, Subunit NIDM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica],6RFR_d Chain d, Subunit NIDM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica],6RFS_d Cryo-EM structure of a respiratory complex I mutant lacking NDUFS4 [Yarrowia lipolytica],6Y79_d Cryo-EM structure of a respiratory complex I F89A mutant [Yarrowia lipolytica],6YJ4_p Structure of Yarrowia lipolytica complex I at 2.7 A [Yarrowia lipolytica],7B0N_p Chain p, Subunit NIDM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica],7O6Y_d Chain d, Subunit NIDM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica],7O71_d Chain d, Subunit NIDM of NADH:Ubiquinone Oxidoreductase (Complex I) [Yarrowia lipolytica]
7AR7_p	2.04e-07	508	567	15	78	Chain p, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B [Arabidopsis thaliana]
7AQW_p	2.80e-07	508	567	16	79	Chain p, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B [Arabidopsis thaliana],7AR8_p Chain p, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B [Arabidopsis thaliana],7ARB_p Chain p, NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10-B [Arabidopsis thaliana]
7A23_f	3.91e-07	508	567	16	79	Plant mitochondrial respiratory complex I [Brassica oleracea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	4.95e-109	150	445	109	393	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	3.59e-88	129	438	47	340	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|Q03015|NDUS6_NEUCR	2.73e-40	488	585	1	98	NADH-ubiquinone oxidoreductase 12 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=nuo-12.3 PE=3 SV=2
sp|Q10359|GMH3_SCHPO	1.81e-23	191	429	112	329	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1
sp|Q09174|GMA12_SCHPO	1.88e-23	155	438	96	358	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000007

TMHMM  Annotations     

Start	End
130	149