CAZyme Information: P168DRAFT_297706-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_297706-t37_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	MSFM01000007|CGC5	40561.68	4.6288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000007:1188182-1189369(+)

Full Sequence      

MFFKTGLTAVLLGASAANAHMIMAKPAPYGAATLNNSPLLADGSDFPCKQRSGVYDAPDE
ETVAQIGQSMPLSFTGTAVHGGGSCQVSLTKDLKPTKDSEWMVIKSIEGGCPANVDGNLP
EGGASPESSLSYKIPEGIEEGKYTLAWTWFNRVGNREMYMNCAPITVEGGSSSKRDVEEK
RDVEKRSTNFPSMFVANVNGCTTKESVDIRFPNPGEDVDRVGSAGNLASEGDDACSGTPS
FGGAGTKKGSSSSGGSSGGSSDSGSAPEPTKPSGGATEAPAPGVFAPTDPATSTPTAPTE
PAEPAQPEPSATTPPAEASSEGSLTGACDEEGLWNCIDGSSFQRCASGQWSEVQAMAAGT
QCQAGQTQNLSVTALKPRMLSAMRHARRAHGGHHA

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA11	20	223	1.8e-75	0.9790575916230366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223021	PHA03247	5.65e-05	196	327	2667	2798	large tegument protein UL36; Provisional
240289	PTZ00144	3.50e-04	202	318	83	185	dihydrolipoamide succinyltransferase; Provisional
273167	rad23	3.80e-04	270	327	77	131	UV excision repair protein Rad23. All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
380203	Vip_LPXTG_Lm	3.84e-04	268	320	283	335	cell invasion LPXTG protein Vip. Vip (Virulence protein), like the LPXTG-type internalins, is an LPXTG-anchored surface protein of the mammalian cell-invading pathogen Listeria monocytogenes, but absent from the related species Listeria innocua. For certain cell types, Vip is required for Listeria's ability to invade. It appears to bind the endoplasmic reticulum (ER) resident chaperone Gp96 as its receptor.
166942	tatB	6.24e-04	267	319	85	135	Sec-independent protein translocase subunit TatB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW31531.1|AA11	4.96e-142	1	393	1	420
QMW43588.1|AA11	4.96e-142	1	393	1	420
BAE61530.1|AA11|1.14.99.53	4.96e-142	1	393	1	420
QRD90522.1|AA11	4.96e-142	1	393	1	420
UDD60467.1|AA11	5.81e-142	1	393	1	404

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAH_A	5.72e-109	20	235	1	216	Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Zn [Aspergillus oryzae],4MAI_A Structure of Aspergillus oryzae AA11 Lytic Polysaccharide Monooxygenase with Cu(I) [Aspergillus oryzae]

Swiss-Prot Hits     

P168DRAFT_297706-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000550	0.999420	CS pos: 19-20. Pr: 0.9565

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_297706-t37_1-p1.