CAZyme Information: P168DRAFT_294406-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_294406-t37_1-p1
• CAZy Family: GH47
• CAZyme Description: FAD/NAD(P)-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1025	MSFM01000001|CGC15	113183.50	5.6830

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000001:1806316-1811316(-)

Full Sequence      

MRLFRVLGVALLATAVTASMKELEAMMPKCALQCMAETLPESGCALTDQTCQCTNEKYTE
ALEKCVVVSCSIREGLTTKNVTSQACGAPIRDRTKAVSIPGIVGMILAIIAYVLRIIARL
RCCGGVFGWDDITMSITMVFVIPLSALSVVLADLGLGRDMWTIPLENITKILYVYFWDEL
LYLSVIPLTKISICCFYLRIFPERRFRTLTYVVIGLNVAYWITFVLISVFQCEPLPGAWH
HWDGEKNYHCNNINAQGWSAALINMALDIFVMVLPLRQLYGLNLSWRKKAYVMCMFSLGI
FVTLVTILRLESLIHFATTENLTWDYVKIGYWSTIECHVGIICACLPAIRSLLRRMAPRA
FGDTERGKTYGTYGSNSQAHNTGGFGVTTQTTDYDYVVVGSGPGGGPLAARLAIAGFKVL
VLDAGDDQGNATVQQVPALQLQSTEYEPMRWDYFVNHYSDLDRQKEDSKMTYRTSSGDFH
VGSNPPADAEPLGILYPRAGTLGGCASHNAMVTIYPFERDWEQLAALTGNDSWSAENMRN
YFKRLERNRYMPSSLMGHGFDGWLTTSLTNLQLVIEDAKILSLILAGATAAGKTILGKAI
TTVAGLAGVLLRDLNNPFPTRDFETGPYQVPLAVDVPEYKRTGPRDFLMDTANARNDDGS
RKYHLDFQLTTLVTKVRFDHSGPTPRAVGVDYLSGQSLYRADPRATKESRGKPGHVTAKR
EVIISAGSFNTPQLLKLSGIGPKDELSRFGIDTVVDLPGVGKNLQDRYETGTIGKAPSDF
FLTSKCTFGYTLPDPCLDQYENNPLNKGTYTTNGIAIAIIRKSSVAAEDEEPDLLVSGAP
TNFPGYYPNYAKEGLSDAQHWTWITLKARSRNNAGTVELRSTDPRDTPLINFHSFDTGVT
ENGADEKDLQAVYEAMEFSRTIFDDLIPLDGGFEEVWPGPNVTTEKDLKDFIKRDAWGHH
ACCTAAIGDDEDPNAVLDGDFRVRGVDGLRVVDASAFPKIPGWYIALPIYMISEKAAEVI
IADAK

Enzyme Prediction     

No EC number prediction in P168DRAFT_294406-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	393	1022	3.6e-93	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.04e-62	388	1025	2	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.87e-62	408	1020	20	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	2.68e-32	869	1016	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.32e-17	494	769	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
399033	CFEM	4.94e-17	25	87	3	66	CFEM domain. This fungal specific cysteine rich domain is found in some proteins with proposed roles in fungal pathogenesis. The structure of the CFEM domain containing protein 'Surface antigen protein 2' from Candida albicans has been solved.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW39616.1|AA3	0.0	392	1024	47	677
QMW27545.1|AA3	0.0	392	1024	47	677
QRD81945.1|AA3	0.0	392	1024	28	658
UDD55433.1|AA3	0.0	392	1024	47	677
BCS05589.1|AA3	0.0	405	1024	49	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	1.50e-38	393	1020	40	597	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3NNE_A	8.15e-37	393	1020	13	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	8.15e-37	393	1020	13	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	1.97e-36	393	1020	13	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
5OC1_A	8.30e-35	393	1023	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1U8QYA8|CICC_EMENI	2.73e-44	385	1024	27	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	7.34e-42	392	1023	3	533	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|Q5B8A1|PKFF_EMENI	1.78e-41	381	1020	32	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q7MF12|BETA_VIBVY	1.26e-40	394	1021	5	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=betA PE=3 SV=1
sp|Q6UPE0|CHDH_RAT	2.14e-40	393	1020	45	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000286	0.999699	CS pos: 18-19. Pr: 0.9859

TMHMM  Annotations     

Start	End
96	118
125	147
180	202
209	231
255	277
290	308