CAZyme Information: P168DRAFT_293631-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_293631-t37_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42312.52	4.8594

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000015:488967-490097(-)

Full Sequence      

MQTGRSVRLVVALSLSFVILYSFYLGWPQVPSQVFSSSQTSSPPPSEATQPATGDADTSP
WYNTDPTPDSHWSSDPKSRPPNAEPSGYTIPEKVWHSAKFDNITDQQREWTNSWKAKNPS
CRQELLNDEAGAAFVRTHYYETRPDIVEVYEQIPIPIFRADLLRYLIVLAEGGIWSDLDV
TCEKPIADWVPEEHKREKISMVVGIEWDFEWRGPDKQVASQFCNWAFMAEPWSRHLMMVV
NSVVDKLKEIANSNGVPVSGITLDMLPVDVVDVTGPKIMTIAILKSLAEMLGRPVDDRDF
AHTKTPRLVGDVLILPGAAFAAQNNGFPQDQGDVFVSHHYEGSWKEADAAAKERKKQQQE
QQQKQQEQQQGKQTSA

Enzyme Prediction     

No EC number prediction in P168DRAFT_293631-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	108	192	5e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.00e-19	51	350	42	344	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.52e-15	112	193	9	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK48128.1|GT32	3.89e-131	1	353	7	348
CAK46331.1|GT32	2.24e-125	4	353	63	408
BCS14453.1|GT32	5.60e-122	4	353	12	360
BCS02801.1|GT32	1.72e-121	4	353	46	394
QKX62870.1|GT32	1.26e-116	1	353	6	372

PDB Hits     

P168DRAFT_293631-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	8.76e-34	90	346	142	395	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	3.53e-24	90	345	130	388	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	7.52e-21	90	346	99	377	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	3.01e-13	90	346	96	471	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	1.77e-07	81	186	46	147	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999580	0.000438

TMHMM  Annotations     

Start	End
7	29