CAZyme Information: P168DRAFT_289564-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_289564-t37_1-p1
• CAZy Family: GH36
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MSFM01000005|CGC5	50938.53	4.5401

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000005:265407-266936(-)

Full Sequence      

MILPQWLWAVCLTVFVAGRGALGLELKADDEDSIKEAAATTAYNMMSQYSGNETGQVPGK
LGGTWWEGGAMFMTLIQYWYWTGDDSYNGPVSQGMYWQKGNDDYFPSNYSNYLGNDDQVF
WGLAAMTAAELNYPEDEGESSWLSLAQGVFNTQVPRWDTTTCGGGLRWQIYPYQEGYGTK
NSVSNGGLFQLASRLARYTNNETYSEWADKIWDWSSQSPLVQPDRWFVADTTDLDTNCKN
AGNLQWTYNYGMYLNGAAYMYNLTDGDDKWKHRVDGLLKSVEKTFFPKKHGSNVLSEVAC
EPNMMCDRNQDCFKGFLAAWLTFMTTIAPYTSDRIIPKIQASAEAAAKQCSGGKSGSACG
RRWYQPKWDGSTSLESDMSALSIMSSAMIAHRKTGDGGKGGNGPFTSDSGGKSKGNPHAG
TGSTDDGSDDKLEPITTGDKAGAGILTAVFAGGWVGATAWLLYGL

Enzyme Prediction     

No EC number prediction in P168DRAFT_289564-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	392	2.4e-104	0.9441340782122905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	3.17e-179	33	381	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR95806.1|GH76	2.21e-250	1	464	1	461
BCS08339.1|GH76	2.21e-250	1	464	1	461
CAK43770.1|GH76	7.20e-243	1	464	1	455
QMW25974.1|GH76	1.42e-233	4	464	3	456
QRD87981.1|GH76	1.42e-233	4	464	3	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.30e-99	27	440	29	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	9.04e-107	12	463	10	449	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q5AD78|DCW1_CANAL	4.44e-105	26	462	21	451	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.17e-103	12	463	7	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	4.30e-102	9	462	9	450	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q9P6I3|YHG7_SCHPO	1.03e-97	31	463	27	442	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999743	CS pos: 23-24. Pr: 0.8780

TMHMM  Annotations     

Start	End
441	463