CAZyme Information: P168DRAFT_289485-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_289485-t37_1-p1
• CAZy Family: GH32
• CAZyme Description: putative unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		41419.58	6.3377

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000004:2088975-2090078(+)

Full Sequence      

MALEHPPPQVRETIDRLIDNLVHIEDKSGQFLLHLPDGRVIDTKSWHGWEWTHGIGLYGL
WKYYELTGDKALLRVIEDWFAARFAAGGTTKNINTMAVFLTLAYVYEHTRNPVYLPWLDA
WAEWAMHDLPRTRHGGMQHMTYLSENSQQLWDDTLMMTVLPLAKIGLVLARPAYIAEAKR
QFLLHVQYLFDVRSGLFFHGWTFADGGHHFARARWARGNSWLTMAIPEFVELLDLAEGDP
IRVHLLETLEAQCAALEQLQDGATGAWHTLLNLADSYVEMSATAGFAYGVLKAVRKRYIG
AQYAAVAKRAIGAVMDKVDAQGELQMTSFGTAMGDSLEFYTRIPLTAMPYGQAMAIMALG
EYLRGSI

Enzyme Prediction     

No EC number prediction in P168DRAFT_289485-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	364	3.4e-103	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.30e-101	20	364	7	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	7.34e-95	24	364	2	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE56723.1|GH105	6.77e-210	1	365	1	364
QMW46699.1|GH105	1.36e-209	1	365	1	364
QMW34630.1|GH105	1.36e-209	1	365	1	364
QRD93550.1|GH105	1.36e-209	1	365	1	364
UDD63587.1|GH105	1.36e-209	1	365	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	6.63e-173	9	364	7	370	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3QWT_A	2.07e-159	9	364	25	378	Chain A, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.02e-157	9	364	26	379	Chain A, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3K11_A	8.82e-19	170	364	221	412	Crystal structure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O31521|URHG1_BACSU	1.48e-43	49	364	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	1.73e-07	166	327	10	182	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	1.73e-07	166	327	10	182	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
sp|P9WF04|UH105_ALTSL	1.33e-06	151	290	201	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_289485-t37_1-p1.