CAZyme Information: P168DRAFT_285567-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_285567-t37_1-p1
• CAZy Family: GH3
• CAZyme Description: alpha/beta-hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MSFM01000016|CGC5	28046.07	4.0311

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000016:146371-147177(-)

Full Sequence      

MVRSILPTLALGLLTTAYAADSPGCGKEPTLTSGIHNIDDREYILEVPEGYDSSKPYKLI
FGLHWRGGNMNNIVDGQSVEPWYGLATRAEGSAIFVAPNGRDAGWANNGGEDIAFIDAII
EQVEADLCVDQSARFSTGFSWGGGMSYALACARASAFRAVSVLSGGVISGCDGGTDPIAY
LAIHGINDPVLPFDGGVELANQFAQNNGCQPAEVAQPPPGSGQSARTDYECSERPVSVIA
YDGGHDAAPLGVGNPLAPDATWEFFNAE

Enzyme Prediction     

No EC number prediction in P168DRAFT_285567-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	40	169	2.7e-22	0.5859030837004405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	7.07e-20	41	265	47	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
226584	COG4099	2.16e-05	43	197	176	335	Predicted peptidase [General function prediction only].
223489	DLH	1.71e-04	116	192	96	173	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	2.83e-04	48	202	385	576	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
402228	Esterase_phd	0.004	109	215	74	207	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSB17085.1|CBM2|CE0	5.47e-90	24	266	38	286
EGX54170.1|CBM1|CE0	1.28e-87	22	266	94	353
AYC36484.1|CBM2|CE0	3.34e-84	17	265	39	302
SHH50044.1|CBM2|CE0	5.60e-84	19	265	49	311
QUC63414.1|CBM2|CE0	1.46e-83	19	265	35	296

PDB Hits     

P168DRAFT_285567-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CDX2|FAEC_ASPTN	8.51e-153	5	265	7	267	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	1.10e-148	1	267	1	269	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|B8N7Z6|FAEC_ASPFN	9.02e-148	1	267	1	269	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1
sp|Q2UI81|FAEC_ASPOR	1.05e-146	1	267	1	269	Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=faeC PE=3 SV=2
sp|A2QYU7|FAEC_ASPNC	1.42e-144	1	267	1	269	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999696	CS pos: 19-20. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_285567-t37_1-p1.