CAZyme Information: P168DRAFT_282623-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_282623-t37_1-p1
• CAZy Family: GH2
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		72591.38	4.6663

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000007:1415104-1417237(-)

Full Sequence      

MLSKSLAVAAAVSALMPLASAFDAQSKSNVAIYYVWTICWPSLLPVLLDLALTFIQGQGY
DQPRLSRFCDDPALDIINIGFINVFPDEGDAGWPGSNFGNQCNGEYYEIGGVKTQLLSGC
HQLIEDIPICQQAGKKVLLSLGGSSPADKQRVRSDESAIQFADFLWAAFGPQTDAWVEIG
GPRPFGDVVVDGFDFDIEHNGDFGYDTMVRRLREHYAAVTDRSFYISGGPQCIIPDAQLG
RAISNSWFDFIWVQFYNTWGCSARDFFSPSSPGASFNYDAWVEVIKDGANPSAKLYMGLL
GGDISQNGFYLSPNEVQLLVSRYMDLYPDTFGGVMIWEATSSELNQVNGSSFAGNVKAIL
DGRASTPAPLPSSSAPVPSPTPSKTSTSSRPVIPTVTSTSRGRPTGTPSSSRAIPSSTAS
PSSSETPTASSHSVSFLHPTAESSTPSTTLVAITSAPTTVTTVIVTSYTTICPTGFITIT
TTYTTTYCPGTATATATSDPLSVTGSTPSVPEGWTTTVTVCTQCAATPTTVTLTVPVQTT
TNPPAHLVSQASTAPALPEGWTTTVTVCTECAPTPTALTITVPVAAVNKATSGHEAPSSS
TETYTLIPIHVHPTSSRPLIPGAGAGSAPHSSTLAVRPSPSGSARASHAWVTVIPSGTQE
ETPVFTGAGVRSVSLSEGVAALVVVGLTVFAVL

Enzyme Prediction     

EC	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	75	299	1.7e-19	0.5371621621621622

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	2.42e-107	57	358	8	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	6.40e-17	64	339	13	304	Glycosyl hydrolases family 18.
119363	GH18_CTS3_chitinase	1.19e-07	122	338	60	252	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119359	GH18_EndoS-like	2.14e-07	76	273	1	193	Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins. The endo-beta-N-acetylglucosaminidases have a glycosyl hydrolase family 18 (GH18) catalytic domain. Some members also have an additional C-terminal glycosyl hydrolase family 20 (GH20) domain while others have an N-terminal domain of unknown function (pfam08522). Members of this family include endo-beta-N-acetylglucosaminidase S (EndoS) from Streptococcus pyogenes, EndoF1, EndoF2, EndoF3, and EndoH from Flavobacterium meningosepticum, and EndoE from Enterococcus faecalis. EndoS is a secreted endoglycosidase from Streptococcus pyogenes that specifically hydrolyzes the glycan on human IgG between two core N-acetylglucosamine residues. EndoE is a secreted endoglycosidase, encoded by the ndoE gene in Enterococcus faecalis, that hydrolyzes the glycan on human RNase B.
119350	GH18_chitinase_D-like	4.55e-07	122	358	61	311	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE61604.1|GH18	3.23e-150	3	374	4	348
QRD90437.1|GH18	1.24e-148	3	374	4	348
QMW31454.1|GH18	1.24e-148	3	374	4	348
QMW43512.1|GH18	2.44e-148	3	374	4	348
UDD60388.1|GH18	2.44e-148	3	374	4	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XVN_A	2.78e-129	52	360	3	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	2.88e-129	52	360	4	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XTK_A	2.88e-129	52	360	4	308	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	3.27e-49	49	366	7	293	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	1.65e-35	57	338	8	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QUQ2|CHIA1_ASPNC	2.42e-142	1	375	1	352	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|Q873Y0|CHIA1_ASPFM	1.53e-130	3	375	4	349	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	2.88e-129	3	375	4	349	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|G5EB30|CHIA1_EMENI	2.01e-110	11	360	11	336	Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiA PE=1 SV=1
sp|Q92223|CHIA1_EMEND	2.01e-110	11	360	11	336	Endochitinase A OS=Emericella nidulans OX=162425 GN=chiA PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.082968	0.917009	CS pos: 21-22. Pr: 0.9083

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_282623-t37_1-p1.