CAZyme Information: P168DRAFT_282612-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_282612-t37_1-p1
• CAZy Family: GH2
• CAZyme Description: SGNH hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647	MSFM01000007|CGC7	71238.75	4.9728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000007:1385480-1388561(-)

Full Sequence      

MRPTSLPLAFASLLLLAPSVYSTPVAQPLETPAHNDTDNATEKPFALRTMPLGASITFGE
RSTDKNGYRGWLRKQMRFAGWDVNMVGSVKSGEMEDNDNEGHSGFVVKQVAKEAEKTIPQ
APNLILINAGTNDAIQNNDIDTIDDRMNALLDRLFTIPDTTVILSTLIPNGNPGVQPRVD
RINTQYRDIVRRRRQEYNRIVLAEMSQFIKLSDLQDDDKTHPTDAGYKKMAAVWWAAIEQ
AEKESLLRAPKKIEKGGKCEEGGHGGGDDVVDDDKGRVLRIGSTPHPDQAYSGVRFANLV
KKSEKASVDELVWARDGESMLMFGNDGEGKFGKPVEIAVKEGCVASDIRWADFNNDGLDD
FICIAHNGGMSVSINKGGNPPKFESIGHVRPGLDGVLGQGDVRLGDIDGDGRVDYCLVAN
NDLYCWRNGGQRKTRTTKTQVSWQFMGLVVQGKDSKHDIADVQLADIDGDNRSDLVWVED
KGKVTALINTPASGKGSTVPEFKDAGALFGDVKNIKVDKDRVRFGSVYPNGGSDYAVVES
EESGDKWDHYLRVWKNTKENPAKPKLGEKKPVDVRELDPRFVIVHTSETESESESSKTCP
VDDKAAKDDGDVSVDPRLPVYAHTSSDSFDYNITPPQVSWYLNVLLL

Enzyme Prediction     

No EC number prediction in P168DRAFT_282612-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	47	238	1.4e-59	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	2.40e-45	47	238	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	6.85e-17	52	229	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	5.48e-16	52	237	4	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238870	SGNH_hydrolase_like_1	6.50e-12	52	237	5	185	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. Myxobacterial members of this subfamily have been reported to be involved in adventurous gliding motility.
225353	TesA	6.81e-09	52	246	14	216	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD56943.1|CE0	3.31e-177	43	556	52	587
CCT73237.1|CE3|GH43_30	1.91e-91	45	556	77	618
AEO70515.1|CE3	1.61e-85	43	556	99	619
BAE62547.1|CE3	4.46e-84	43	253	52	261
CCT65127.1|CE3	2.31e-83	34	565	36	622

PDB Hits     

P168DRAFT_282612-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P168DRAFT_282612-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000301	0.999671	CS pos: 22-23. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_282612-t37_1-p1.