CAZyme Information: P168DRAFT_282134-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_282134-t37_1-p1
• CAZy Family: GH2
• CAZyme Description: putative BNR/Asp-box repeat protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42200.33	6.8137

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000006:1540958-1542103(-)

Full Sequence      

MPGKLGQKILKTFGIDHPHHPPPNQPPPQQPPTDHGARLPGNRVIENDERLLAAIPNGTY
ARLARMSDGSLLGSFTRFEGNQRLLRVTRSTDGGRTFEPWGEVTRAAGDCDNLFLLEIAP
GTVLGAFRNHDMKPGGGFTHFRITVCRSTDGGRNWSYLSQAAEKNPPMGIWEPFMRMGRQ
GEVQLYYSEEFAPENQCTMLVRSFDGGATWTPPQCLGGERDNYRDGMTSIAVAHDRGREV
LVLVFETTTHRAFSIESMLSYDDGQTWGWRHEVYRSHKSGRHAGSPGIATFADGSLAVVF
MTDEDWPNPHWHHNASIKVLFGGPPQDGRIFWTRPTVLCPEASHWPGIQAVDGHTLLGTY
ECGGAPKAKAITLDMQQEQSG

Enzyme Prediction     

No EC number prediction in P168DRAFT_282134-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	56	308	1.8e-68	0.8762214983713354

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	5.36e-13	73	308	101	330	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	5.13e-11	52	373	19	335	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
404074	BNR_2	0.010	67	158	171	254	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW42642.1|GH93	2.47e-172	1	373	1	378
QMW30589.1|GH93	2.47e-172	1	373	1	378
QRD89469.1|GH93	2.47e-172	1	373	1	378
UDD59403.1|GH93	2.47e-172	1	373	1	378
BAE60328.1|GH93	4.97e-172	1	373	1	378

PDB Hits     

P168DRAFT_282134-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

P168DRAFT_282134-t37_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_282134-t37_1-p1.