CAZyme Information: P168DRAFT_278889-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_278889-t37_1-p1
• CAZy Family: GH18
• CAZyme Description: xylanase G1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
221	MSFM01000001|CGC23	23759.94	4.4093

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000001:4881776-4882489(-)

Full Sequence      

MFNLKSILFAASVASVASAAPNGKALLELVKRQATEPGTGTNNGYFYSFWTDGGGDVTYT
NGEGGQYSVEWKDTGNFVAGKGWNPGSAKVINYSGTWNPSGNSYVSVYGWTTDPLIEYYI
VDSFSTYDPSTGAEQLGTVESDGGTYNIYKTTRVDAPSIIGTATFDQYWSVRTEHRVGGT
ITVQNHFDAWSKSGLTLGSHDYLILATEGYQSSGSASMTLE

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	43	218	2.7e-77	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	4.92e-107	43	217	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZD35661.1|GH11	4.28e-115	1	221	1	220
BCR86019.1|GH11	1.52e-110	7	221	15	229
BAA19744.1|GH11	6.65e-110	1	221	1	221
QRD93485.1|GH11	6.65e-110	1	221	1	221
BAE56664.1|GH11|3.2.1.8	6.65e-110	1	221	1	221

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TE1_B	1.02e-93	39	220	8	189	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
3WP3_A	3.66e-93	28	220	13	206	Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus],3WP3_B Xylanase 11C from Talaromyces cellulolyticus (formerly known as Acremonium cellulolyticus) [Talaromyces funiculosus]
5K7P_A	5.86e-93	33	220	1	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]
4XQD_A	2.30e-92	36	220	3	188	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
1ENX_A	2.38e-92	36	220	4	189	Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1ENX_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1RED_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1RED_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REE_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REE_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REF_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1REF_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYO_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYO_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYP_A Chain A, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],1XYP_B Chain B, ENDO-1,4-BETA-XYLANASE II [Trichoderma reesei],2DFB_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],2DFC_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],3AKP_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKP_B Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKQ_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKR_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKS_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKT_A Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3AKT_B Crystal structure of xylanase from Trichoderma longibrachiatum [Trichoderma longibrachiatum],3LGR_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4HKW_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2D_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2F_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2G_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4S2H_A Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],7MGU_A Chain A, Endo-1,4-beta-xylanase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DNU5|XYNB_NEOFI	3.05e-113	1	220	1	220	Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnB PE=3 SV=1
sp|B8NJ86|XYNB_ASPFN	1.18e-110	1	221	1	221	Probable endo-1,4-beta-xylanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xlnB PE=3 SV=1
sp|P87037|XYNB_ASPOR	1.18e-110	1	221	1	221	Probable endo-1,4-beta-xylanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xlnB PE=1 SV=1
sp|Q4WLV2|XYNB_ASPFU	1.68e-110	1	220	1	220	Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=xlnB PE=3 SV=1
sp|B0Y8Q8|XYNB_ASPFC	1.68e-110	1	220	1	220	Probable endo-1,4-beta-xylanase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=xlnB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000347	0.999639	CS pos: 19-20. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_278889-t37_1-p1.