CAZyme Information: P168DRAFT_278790-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_278790-t37_1-p1
• CAZy Family: GH18
• CAZyme Description: long-chain fatty alcohol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
747		81473.21	8.0023

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000001:4570875-4573239(+)

Full Sequence      

MADQTIPYTPLPVSIPPVSQEQLFSELQWTTLLSIASTVVPRIRSRGGSRSSSDKQVSKA
VYDQALASLTAKIHDPDAGVIAAQYLAEDVSTNAAFRENIQRLFTTYVHQEGRNGISLIL
NVLNTRAGSLLLTGSMTPFQNQPFEVRENVFRGWETSRLKPLRAVFRALSAISRRTWIVT
SPTALQAIGFPQVPAHGQPRDSHPFEFLGFPGGDRPEIIETDVVIVGSGCGGGVAAKNLA
EAGHKVIVVEKAYQYSSRNFPMSFDQGFVSMFEGSGAVTTDDGTMGVFAGSVWGGGGTVN
WSASLQTQGYVRQEWADGGLPFFTSMEFQNSLDRVCERIGASSEYTRHNHQNRVLLEGAR
KLGYSASAVPQNTGTHEHYCGHCTMGCHSAEKQGPTETYLADASKAGAQFIEGFHVDRVL
FTNTKAGRVASGVEGTWTSRDAWCGQSGPTAIKRKVIINSKKVVVSCGTLQSPLLLLRSG
IKNPQVGRNLHLHPVVIGGAVFDEETRPWEGAALTTVIDEFEDLDGHGHGVKVECLTMLP
PAFLPAFTWRDGLDWKMWTAKLSHMAGFITLTKDRDTGRVYPDPVDGRLRIDYTPSVFDR
KHIVEGIVTAAKVAYIAGAKEFRTSYRDMPPFVRPDPANTNSAEGTNNAALQAWISELRR
KTPCDPERTMFASAHQMGTCRMGSSVRSSVVDPECQVWGTRGLYVMDASVFPSASGVNPM
VTNMGIADWASQKLAKSLDKQMSKTRL

Enzyme Prediction     

No EC number prediction in P168DRAFT_278790-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	220	735	2.3e-69	0.9653284671532847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
366272	GMC_oxred_N	5.61e-59	271	495	4	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
225186	BetA	8.60e-43	222	736	9	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.64e-30	574	727	1	140	GMC oxidoreductase. This domain found associated with pfam00732.
274888	Rv0697	1.32e-12	221	735	1	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
235000	PRK02106	7.53e-10	415	713	223	510	choline dehydrogenase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK96886.1|AA3	8.14e-202	9	745	10	741
BAE61169.1|AA3_1|AA8	1.01e-17	222	734	255	786
UJO19303.1|AA3_1|AA8|CBM1	2.57e-17	222	734	273	805
QMW43910.1|AA3_1|AA8	3.23e-17	222	734	309	840
QMW31885.1|AA3_1|AA8	3.23e-17	222	734	309	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	2.90e-14	216	734	225	763	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI4_A	1.41e-12	216	734	3	542	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI6_A	1.79e-12	216	734	225	764	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
2JBV_A	1.95e-07	462	728	264	520	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.95e-07	462	728	264	520	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B5WWZ9|FAO2_LOTJA	4.94e-90	116	741	96	749	Long-chain-alcohol oxidase FAO2 OS=Lotus japonicus OX=34305 GN=FAO2 PE=2 SV=1
sp|Q94BP3|FAO4B_ARATH	9.63e-87	91	741	62	745	Long-chain-alcohol oxidase FAO4B OS=Arabidopsis thaliana OX=3702 GN=FAO4B PE=2 SV=2
sp|B5WWZ8|FAO1_LOTJA	5.22e-83	116	740	92	746	Long-chain-alcohol oxidase FAO1 OS=Lotus japonicus OX=34305 GN=FAO1 PE=1 SV=1
sp|Q9ZWB9|FAO1_ARATH	2.32e-81	219	741	244	755	Long-chain-alcohol oxidase FAO1 OS=Arabidopsis thaliana OX=3702 GN=FAO1 PE=3 SV=2
sp|Q9LW56|FAO3_ARATH	3.51e-80	118	743	89	745	Long-chain-alcohol oxidase FAO3 OS=Arabidopsis thaliana OX=3702 GN=FAO3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_278790-t37_1-p1.