CAZyme Information: P168DRAFT_274505-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_274505-t37_1-p1
• CAZy Family: GH16
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
616	MSFM01000011|CGC7	66875.38	6.5548

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000011:1474151-1476116(+)

Full Sequence      

MTTPPSAGSAICSLNEFLQVSYDYIIVGGGTAGLAVAARLSENPSVTVGVIEAGSDQTHN
ELVQTPALFPQMLGIPEYDWMLETVPQRANRYKVHAQTRGKMLGGSSAMNGMMYVRGSKQ
DYDDWSTFGKGWSWSSMAPYFRRHETFDDTRIGPPGDDDFTQFRTHSHGRTGAIATSFNN
WRNPLERYFIQAGQQASGIDRSPSDPWGGDHVGFFSSLATVDRRNVRGTRSYAASAYLLP
NASRSNLRVLTNALALRVLMEGRTARGVQFMHSDKIREVRATREVILSCGVYKTPQLLEL
SGIGDPVVLQDAGVKCTVPLPGVGANLQDHVLTAAVYELNEGITSLDALRHPSILQEHVD
MYAKDSTGLLASATSGMGFLPYSRIVSPAELERTCQKILDSPAQTPFQRKQREQVVGQLR
SPTSGNIQFILSQGTLNVDEVVANQGKFAKPLAETDPDGFTIVACLEYPASRGTVHITSG
DPTVNPAVDPAYLSHPADVDILAAGLGFCDEIAQSPALKDKIRRRAHPTGDIRDRSRATE
AVRDFCMTEYHPCGTCAIGSVVDERLRVRGVTGLRVVDASVFPGNVSGNILSTVYAVAEK
AADLIKEDASWVHPSL

Enzyme Prediction     

No EC number prediction in P168DRAFT_274505-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	21	608	2e-175	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.70e-127	21	614	5	548	choline dehydrogenase; Validated
225186	BetA	4.96e-113	21	609	7	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.96e-37	469	601	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	2.79e-33	99	330	23	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.48e-22	21	584	55	558	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS29957.1|AA3_2	0.0	1	616	1	618
SMQ52591.1|AA3_2	4.37e-181	17	612	32	631
SMR55413.1|AA3_2	4.37e-181	17	612	32	631
SMR57790.1|AA3_2	4.37e-181	17	612	32	631
SMY26225.1|AA3_2	4.37e-181	17	612	32	631

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	7.44e-69	22	608	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	3.99e-68	22	608	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
4YNT_A	8.63e-68	21	609	5	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	3.61e-59	21	608	5	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3LJP_A	9.75e-58	11	606	3	527	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	2.04e-157	16	611	8	614	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	2.04e-157	16	611	8	614	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	3.20e-153	13	608	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	7.28e-86	15	608	33	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	8.08e-82	21	605	46	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999973	0.000060

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_274505-t37_1-p1.