CAZyme Information: P168DRAFT_273739-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_273739-t37_1-p1
• CAZy Family: GH16
• CAZyme Description: putative UDP-glucoronosyl and UDP-glucosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		55553.34	7.3422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000011:298894-300532(-)

Full Sequence      

MPDKPSVLFITNSELGQAAVHLAVAFEFLIRVSYKVHIASFAPIDDALEDLHRRLNQMPW
NTGRPYFHRINGPSMVEFVRKKTGVRGSFDAHPTGLCGAMKTYNSLLHSTIMPWDGIQYM
EIYRDCEQIIQQVQPVVAVVDPLLLPAVDVCRTMGQRMVKLGPSTVLTHVRQPYLANLWK
YPSLCSGYSYPLPWYLLFPNTILGIHLRRSLSSCKQCDEVEDYRNRCGIPGPIPSILVAD
TDKTPFILSSMSYTDFPCHVPEQFTLCGPILRASAPVTQEMPELANWLSRRPTVLVTMGS
HLRYDSNNRRQFAEGLRMLLDQMPRAQILWKMVREPEPGVDDDDKTDPALACLHPAIITD
RVRIEPWLYADPIVILESGHVPLMVHHGGANSYQEAVKAGIPQVVVPVWFDTHEYAARVK
HLDIGVWVRWNHSSKTNGKMLGNAMLQVVQSTSMQINAMTLAVRLGPVEGRVLAWEKIQD
ILAEERAGNPFCG

Enzyme Prediction     

No EC number prediction in P168DRAFT_273739-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	245	464	1.6e-17	0.44502617801047123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	8.11e-21	173	462	115	386	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	7.63e-08	380	429	300	349	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	8.54e-06	289	453	294	434	ecdysteroid UDP-glucosyltransferase; Provisional
278624	UDPGT	2.87e-05	255	461	238	418	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS26405.1|GT1	3.23e-143	6	482	5	483
QMW30045.1|GT1	1.16e-139	6	484	5	483
UDD61742.1|GT1	1.16e-139	6	484	5	483
QMW42118.1|GT1	1.35e-136	6	474	5	473
BCR88350.1|GT1	3.57e-134	5	493	2	504

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IPB_A	2.06e-06	268	420	19	148	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
7CJX_A	2.61e-06	270	420	1	127	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
2O6L_A	3.77e-06	273	462	3	165	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	2.26e-84	4	477	5	462	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	3.86e-76	4	427	5	431	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|Q63ZR6|UD3A1_XENLA	6.52e-11	251	462	248	441	UDP-glucuronosyltransferase 3A1 OS=Xenopus laevis OX=8355 GN=ugt3a1 PE=2 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	3.02e-10	360	490	440	552	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|M9MH90|EMT1_PSEA3	4.95e-09	360	490	441	553	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_273739-t37_1-p1.