CAZyme Information: P168DRAFT_268751-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_268751-t37_1-p1
• CAZy Family: GH134
• CAZyme Description: FAD-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
496	MSFM01000006|CGC7	53958.59	9.5843

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000006:307478-309043(+)

Full Sequence      

MLWRPLTQLLALLSLASVVLSSSSICDRLRSQIPGRVVLPREPLYAELESSYYSQYERAL
KPSCIFRPTRTAEVSEFIHFVNENANASSSPLKFAVRGGGHTLFSGAANIKDGITVDMRS
MKSLVLSADRKTASVGGGSIFSDLYGQLDRHNLTVMGGRVPGIGVGGFTTGGGLNFLSRD
HGYSCDNVYGYEVVLGNGSVVHATASANRDLWLALKGGSNNFGIVTRFDLATFPQKAMWG
GVLLFKYSQAMVDAQAKAFSEYMNPANFDGAADMAVIMNFADGGFSTGDSLFYTKPVVNP
PVYRGFTSFPSPVKNTLALNNVSGMVRKFGETLPPKLNLTTEYVYSFKNPSPATYKELFQ
IWEQGCRALAHIKGLQVQYLVQPQPVTNGTNSLGQPAGEKDKVMGLVTVAFDNPADEVAA
LQGARNIVLLQGAVLRREGLYSPFQYLNYAEKSQDPIGSYGKEMLNRLRAVSRKYDPAEL
FQKSVPGGFKLFGKRG

Enzyme Prediction     

No EC number prediction in P168DRAFT_268751-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	61	257	1.3e-53	0.4126637554585153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	2.39e-19	28	481	1	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	8.40e-18	62	204	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
215242	PLN02441	4.99e-13	60	239	63	247	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD00400.1|AA7	4.08e-23	21	258	6	236
APA09402.1|AA7|CBM18	2.43e-21	62	317	77	334
CDR44461.1|AA7	1.83e-20	62	483	70	509
CCD53507.1|AA7|CBM18	3.33e-20	62	262	77	271
ATZ50223.1|AA7|CBM18	3.33e-20	62	262	77	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FYD_A	4.01e-24	35	229	20	205	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYG_A	7.27e-24	35	229	20	205	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]
6FYF_A	7.27e-24	35	229	20	205	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYE_A	1.32e-23	35	229	20	205	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYB_A	1.32e-23	35	229	20	205	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M2T7Z1|TPCD_COCH5	7.83e-74	46	491	63	517	FAD-dependent monooxygenase tpcD OS=Cochliobolus heterostrophus (strain C5 / ATCC 48332 / race O) OX=701091 GN=tpcD PE=1 SV=1
sp|A0A2G5ICA0|CTB5_CERBT	1.46e-72	19	491	38	524	FAD-dependent monooxygenase CTB5 OS=Cercospora beticola OX=122368 GN=CTB5 PE=3 SV=1
sp|A0ST43|CTB5_CERNC	3.98e-67	51	491	3	456	FAD-dependent monooxygenase CTB5 OS=Cercospora nicotianae OX=29003 GN=CTB5 PE=2 SV=1
sp|A0A0U5GQ05|DRTC_ASPCI	3.25e-60	26	491	45	513	FAD-dependent monooxygenase drtC OS=Aspergillus calidoustus OX=454130 GN=drtC PE=1 SV=1
sp|C8VPE5|SDCF_EMENI	5.21e-57	26	491	9	476	FAD-dependent monooxygenase sdcF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sdcF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000246	0.999738	CS pos: 21-22. Pr: 0.9800

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_268751-t37_1-p1.