CAZyme Information: P168DRAFT_267548-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_267548-t37_1-p1
• CAZy Family: GH13
• CAZyme Description: putative glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655		75405.41	5.5748

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000005:650474-652497(+)

Full Sequence      

MLFAEDDKLVFRFDDHLLWIQPWGENAFRIRATKQASMPTEDWALSEKTNLAQPPSIDIQ
AGKDASISNGKIKATVSHRGKIIIYDSKGNKLLEEYARHRRDPTDPKCSALEVEARELRP
ILGGDFHLTMRFESLDPKEKIFGMGQYQQPFLNLKGADLELAHRNSQASVPFAVSSLGYG
FLWNNPGLGRAVLGTNTMSFEAFSTKSLDYWVVAGDTPAEIEEAYSRVTGRAPMMPEYGL
GFWQCKLRYWNQEQLLEVAREHRRRKVPLDVIVVDFFHWKHQGEWSFDPKFWPDPDAMVK
ELKEMNVELMVSIWPTVENSSENYPEMLERGLLIRHDRGMRVAMQCDGDVTHFDATNPEA
RKYIWEKAKKNYYDKGIKVFWLDEAEPEYSIYDFDIYRYHAGSNLQIGNIFPKEYARGFY
EGMEAEGQTNIVNLLRSAWAGSQKYGALVWSGDIASSWGAFRNQLAIGLNMGLAGIPWWT
TDIGGFHGGNPDDPAFRELFTRWFQWGAFCPVMRLHGDREPKPEGQPTAAGGNNEIWSYG
EEIYEICKKYIFIREELRDYTRGLMREAHEKGTPVIRTLFYEFPQDKKAWDVETEYLYGS
KYLVVPVLEAGQRKTRAYLPQGASWKLWGEGRVHEGGQEVEVDCPIDTMPVFVRM

Enzyme Prediction     

EC	3.2.1.177:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	210	654	1.7e-144	0.9859484777517564

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269877	GH31_xylosidase_XylS	0.0	230	554	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
224418	YicI	4.80e-163	44	654	72	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	4.05e-149	212	654	2	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	1.32e-71	230	654	1	421	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
269879	GH31_xylosidase_YicI	7.55e-69	230	557	1	308	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK58644.1|GH31	0.0	1	654	1	653
KAB8212372.1|GH31	0.0	1	654	1	653
KAE8320666.1|GH31	0.0	1	654	1	653
KAE8134555.1|GH31	0.0	1	654	1	653
KAE8411795.1|GH31	0.0	1	654	1	653

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	5.48e-113	123	652	132	704	Xylosidase from Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
7KMP_A	5.48e-88	60	654	120	860	Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	7.76e-85	198	654	393	869	crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
5JOU_A	6.86e-79	205	654	372	839	Bacteroides ovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
6JR6_A	2.57e-71	139	654	156	683	Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01336|YCR2_PSEVU	3.05e-207	2	522	4	528	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
sp|Q9P999|XYLS_SACS2	9.36e-114	126	654	100	617	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
sp|A2QTU5|XYLA_ASPNC	4.45e-112	123	652	150	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
sp|A7LXT0|GH31A_BACO1	3.48e-78	205	654	371	838	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
sp|Q9F234|AGL2_BACTQ	4.46e-64	132	654	140	669	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_267548-t37_1-p1.