CAZyme Information: P168DRAFT_265968-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_265968-t37_1-p1
• CAZy Family: GH12
• CAZyme Description: glycoside hydrolase family 2 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653	MSFM01000004|CGC6	72203.03	5.1193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000004:381140-383256(+)

Full Sequence      

MTMEYPRPDFQRSSLNWTSLNGTWLFAFDDTDAGLSQSWPQTGLPASQTRFIKVPYAFQA
PASGIGLREAHEVIWYERTIRDIRLGGAPDQRLILRFGAVDFECSIWLDGVPVGGHTGGH
VPFDLDLTDAFRSLATGGERKETARLTLRVRDSPTDLAQPRGKQYWGPVPESIFYTPSSG
IWQSVWLESIPAMRIGCSSAGTVLRSDDITSGTLHAVVAVTGRQPVAGPVSVQITASLGG
KTVSTSPRSPLPSDKEYVRIDLDVTLPAADRPRGGAFDADGAWHDNGTALWAPEHPILYD
IVLRLYDVAGNLVDEVQTTTGMRSLSWQNGDGTFRLNSKPYFQMLVLDQGYWPETGITPP
SGDALRTDIELVKRAGFNGCRKHQKIEDPLFLYWADRLGFMVWGEIANGYEYSHELVERI
TAEWADSVRRDRNHPSVVTWTPGNESWGYPSLKDNIEQRDHIRCLYYLTKSLDPSRPIND
NCGWEHVQTDLTTYHDYSDSAQLTTTCADFENGILGPKDNGHRAMFVEPISAGSVTLDPG
AKHAPGAPVICSEFGGVNIKPPKDVAASDRDWGYTTASNAADFLVRLEKLVMGIVKGGFT
CGLVYTQLCDVEQEVNGLYAYDRSEKVPPADIKAIMDAAKDYYFQHVAPKSKV

Enzyme Prediction     

No EC number prediction in P168DRAFT_265968-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	12	502	4.1e-95	0.5146276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	7.16e-41	5	479	1	430	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
236657	PRK10150	4.84e-34	3	478	1	445	beta-D-glucuronidase; Provisional
236548	lacZ	1.55e-23	179	478	207	485	beta-galactosidase.
236673	ebgA	2.73e-19	9	476	32	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
397119	Glyco_hydro_2_C	1.21e-14	363	503	36	190	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD91609.1|GH2	0.0	5	650	4	649
QMW47280.1|GH2	0.0	5	650	4	649
QMW35218.1|GH2	0.0	5	650	4	649
UDD64307.1|GH2	0.0	5	650	4	641
CAK44902.1|GH2	0.0	5	650	4	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	5.03e-63	4	623	28	565	Chain A, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	5.78e-22	6	486	16	453	Crystal structure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
5C70_A	4.87e-21	11	478	14	450	The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	1.21e-20	11	478	39	475	The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
6U7I_A	4.44e-20	3	600	1	572	Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_B Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_C Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii],6U7I_D Faecalibacterium prausnitzii Beta-glucuronidase [Faecalibacterium prausnitzii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O18835|BGLR_CANLF	1.32e-22	3	512	27	526	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
sp|O97524|BGLR_FELCA	1.67e-21	3	600	27	609	Beta-glucuronidase OS=Felis catus OX=9685 GN=GUSB PE=1 SV=1
sp|A3FEW8|BGAL_ENTAG	1.89e-20	19	483	55	491	Beta-galactosidase OS=Enterobacter agglomerans OX=549 GN=lacZ PE=1 SV=2
sp|A4W7D2|BGAL_ENT38	3.29e-20	97	483	145	491	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1
sp|Q6D736|BGAL_PECAS	7.63e-20	20	483	63	500	Beta-galactosidase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000001

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_265968-t37_1-p1.