CAZyme Information: P168DRAFT_249649-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_249649-t37_1-p1
• CAZy Family: CE16
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MSFM01000003|CGC3	92737.65	4.5952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000003:1845531-1848351(-)

Full Sequence      

MHRLNLYALCALAFHCLAVFASQAAEHDTSVLAKEAARANNQSLLWGPYKPNLYFGVRPR
IANSLFAGLMWANVDDYGTAQQNFRHTCEQDEGMAGYGWDEYDIRKGGRQTIHDAGNSVD
MTIDFVKVPGGQHGGSWAARVKGVPRDDAPPDQSTSVIFYAALEGLGDLGVETEVDPRGF
EDNVKLAGSTLDLGDFAIDVTAGPASNEHPEHTHPTWEDKPLDRTFVSSATMPPEHLWQT
KVIMFAQMKNEINQCIEKYGADDPPPAPQVFTIPHHPGDGNIHLVQKVFKGAFEFDILFS
SGSAPKPLTSESITDEIASASLSFSDRFEKVFSPQSPFDSAEYSQFSKSMLSNLVGGIGF
FHGTDVVDRSAAPEYDEENEGFWEETEEARARARPIFEGPKDLFTSVPSRPFFPRGFLWD
EGFHLIPVVDYDTSLALEIVKSWINLMDEDGWIAREQILGAEARSKVPPEFTVQYPHYAN
PPTLFIILEAFIDKLDAKKNISTEDLGGDVLDSLRSGYVQEKELGEAYIRSIYPLLKRHY
FWYRKTQYGDVKSYDREAFSTREAYRWRGRSIQHILTSGIDDYPRAQPPHPGELHVDLIS
WMGMMTRALRRIAEAVGETEDVEEFKVYETAIERNIDDLHWDDQAQTYCDATIDEFEESV
HICHKGYISLMPFLTGMLGPESPRLKAILDLIADPEELWSDYGIRSLSQKDEFYGTAENY
WRSPVWVNINYLVLKSLYDLALQEGPHQEQAREMYSELRTNLVENVFRNWKETGFAWEQY
NPDTGKGQRTQHFTGWTSMVVKIMSMPDLPAGGNKGHDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	593	804	3.1e-34	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	308	806	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	6.53e-126	44	266	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	4.46e-07	526	754	358	561	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
236653	PRK10137	6.41e-06	596	798	578	773	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD84190.1|GH63	0.0	1	820	1	817
UDD57712.1|GH63	0.0	1	820	1	817
CAL00956.1|GH63	0.0	1	820	1	822
BCS02288.1|GH63	0.0	1	820	1	822
BCS13967.1|GH63	0.0	1	820	1	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	6.70e-174	34	804	5	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	5.93e-137	44	805	37	776	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	4.12e-249	30	805	28	805	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	6.61e-173	34	804	35	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	1.47e-137	44	805	92	831	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	1.15e-131	46	805	94	831	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	9.47e-131	33	805	83	834	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000577	0.999383	CS pos: 24-25. Pr: 0.9609

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_249649-t37_1-p1.