CAZyme Information: P168DRAFT_248393-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_248393-t37_1-p1
• CAZy Family: CE1
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781	MSFM01000002|CGC17	85577.54	4.7397

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000002:1104505-1107466(-)

Full Sequence      

MVNGLLSKSLLALGLCSSFVAGKDATPPYKDARVPVEDRVSDLLGRMTIEDKMAQLIQGD
ITNWMNDTTGDFNYTGLVENMELKAGMFYVGYPVPWDWIATNVKRAQDYLIHNTTLGIPA
LVQTEGIHGFLIGNATIYNSPIAYGCSFNKDLVYKMAKFIGQEASALGVNQIFAPVVDLA
RELRFGRVEETFSEDPYLSGEIGYSYTKGLQSTNVSAMVKHFIGFSQPEQGLNTGPVQGG
ERHLRTTWFQSFKRSIIDAGAWSIMSAYNSYDGIPAISDYHTLTEILREEWGYKYFVISD
AGATDRLCNAFNLCRSSPIDMESVTLQALPAGNDVEMGGGSFNFQKIAELVEAGKLDIEI
VDTAVSRVLRAKFEMGLFENPYPAAPPEEWKKLIHSKEAVQVARDLDKESIVLLENHDDV
LPLKKSGDIAVIGPMAHGFMNYGDYVVYKSQYRGVTPLDGIKAAVGDKAHVHYAQGCERW
SNDESGFAEAVEAAKKSDVAVVVVGTWSRDQQELWQGLNATTGEHVDVNDLSLVGAQAPL
IKAIVDTGVPTIVVLSSGKPVTEPWLSNSTSALLQQFYPSEEGGHALADVLFGDYNPSGK
LSVSFPHSVGDLPIYYDYLNSGRSIGDSGSQSDDGDLVFGHQYVLGSPLPWYPFGYGKSY
STFEYGRVKLDKTSIEDAQAETVTVQVDVTNRHPDREGTEVVQVYVKDEYASVVVPNREL
KGFEKVVIPAGKTKTVKIPLRVKDLGLWNSAMKYVVEPGAFHVLVGSSSSDIRGNATFTV
E

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	337	2.1e-62	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.33e-158	11	779	9	763	beta-glucosidase BglX.
224389	BglX	1.27e-80	47	478	1	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.88e-64	10	738	11	740	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	3.02e-63	411	660	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.31e-57	48	371	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UDD57574.1|GH3	0.0	1	781	1	779
BAE62006.1|GH3|3.2.1.120	0.0	1	781	1	779
QMW32562.1|GH3	0.0	1	781	1	779
QMW44592.1|GH3	0.0	1	781	1	779
CAP98759.1|GH3	0.0	1	781	1	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	0.0	23	781	1	757	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	0.0	23	781	1	757	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	9.93e-115	1	773	8	778	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	1.24e-111	38	781	11	752	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	3.81e-111	38	773	10	744	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q56078|BGLX_SALTY	1.86e-122	15	773	19	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	3.33e-122	113	769	60	710	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	1.16e-119	26	773	30	758	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH9|PLH34_FORAG	2.50e-100	29	773	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	2.61e-98	116	772	35	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000309	0.999668	CS pos: 22-23. Pr: 0.9725

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_248393-t37_1-p1.