CAZyme Information: P168DRAFT_246859-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_246859-t37_1-p1
• CAZy Family: CBM18|GH18|GH18
• CAZyme Description: putative beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
877		94740.61	6.5631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000001:1870654-1873575(-)

Full Sequence      

MAPSELQTKVGQLFAVGFHGLTPSPEIKTLIHEHALGGIVLFKRNISDVAQLQSLTRALQ
EEARLAGHERPLFIGIDQENGLVTRISPPIAAQMPGPMALGATYSPESAYDAGVITGQTL
QFFGINMNYAPVCDVNSEPLNPVIGVRSPGDDPEFVGRFASATARGLREQKVIPSVKHFP
GHGDTAVDSHYGLPVITKSRDELGRCELVPFRRAAAEGVESVMTAHISLPAIGDGRLPAT
LSPDVLNILRKDMQYDGMIITDCLEMDGIRATYGTEQGAVLSLGAGSDSIMICHTYNVQV
AAIKQVCEAVQSGQIPQSRLDEAYRRVTTLKDQFLDWDTALRVQPPSDLAALNQKGIILA
SEIYARSVTLVRDTKGILPLSPTAQIVFLFPGGTTPAGGAVDGEGLGRPGTYSASPYLNL
LNRHAPSVAEVHYAPTGLSTQQWQAVEAADVVVFVSINARESPYQRSLGLELPNRARKLV
AIAACSPYDFLDDVAAIGTYMTTYEPTLEAFAAATDILFGTAPPRGALPVGESKPTPSTD
IHITQYNPNSDFSGILSVWSAALPTYTPEPDLLSTLLHAHPTQHHFIARNKSTDETTGFA
ILYANPNTKTAHLAVLAVRPSHQNHGIATRLLAAARASLPSGTRIDLGSGIPRFWPGIPT
DLPQSTQSFFINRGFHLNPLKPRSVDLYQSISGLSSTGGKYLAAARQNHISFAPIKQDQY
EECMAGQMRNFSHNADWINLYKTLPPTTHPNIILFAIHTPPPTTTEPPKQIAWLIALPPS
HPILTQNWAFPAFFTRAGQHAGLIGCVGVDKEFRGRGVGLGLVEFAVDYLRHHPYSGGGG
DTTGAAIDGIFVDWVAIEGWYEKVGFDVWRSYRTGYL

Enzyme Prediction     

EC	3.2.1.52:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	291	1.4e-56	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	5.93e-88	9	399	6	370	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	8.74e-83	6	330	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	6.06e-42	33	294	22	281	beta-hexosaminidase; Provisional
185053	PRK15098	1.91e-16	6	530	47	597	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	8.95e-05	368	530	1	187	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR85716.1|GH3	0.0	1	877	1	854
QMW40223.1|GH3	0.0	1	875	1	861
QMW28153.1|GH3	0.0	1	875	1	861
CAP94355.1|GH3	0.0	1	877	1	852
BCR93582.1|GH3	0.0	1	877	1	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	1.28e-142	5	877	8	858	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	2.62e-94	6	529	13	528	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.12e-62	26	331	76	393	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	9.27e-62	26	331	50	367	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.68e-61	26	331	80	397	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.60e-61	26	331	76	393	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|P48823|HEXA_PSEO7	1.64e-57	22	389	50	434	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|L7N6B0|LPQI_MYCTU	2.33e-39	9	331	64	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
sp|A0A0H3M1P5|LPQI_MYCBP	5.81e-39	9	331	64	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1
sp|B2I6G9|NAGZ_XYLF2	2.01e-36	13	294	1	279	Beta-hexosaminidase OS=Xylella fastidiosa (strain M23) OX=405441 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_246859-t37_1-p1.