CAZyme Information: P168DRAFT_244751-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_244751-t37_1-p1
• CAZy Family: AA9
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MSFM01000016|CGC6	44744.56	5.6249

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000016:74673-76109(-)

Full Sequence      

MGIRFLPWVALTVTAVTAAQGQPFSTWMLDSILARQDGITSTGAMTRQIENGIFQEALRA
AIERSDDATQRGRWTKYHHRSVEQDIQEALNASKDALDYGLDRLCLARSLLELPPNGQYD
QQALQALRESIRLQPRNALGGLWYYANPPAPYNYYGDASYGDGMYGYAPYAALWGSITGD
ESLDLNTALQQLELIYRNARDPTTGLVKHGYQLSRNASWADFATGASPVIWGRSLAWYTV
GLVDALELAATKSPAVVVTVTYHRIQALLRDIVVAEIEAVDKSASETGRYGIWQVVDQPG
APGNFIESSAGALITFALAKSLRLGYMGDMHGRVSVLVRKMHQDLVERFVGHNQQGMLDY
FGTSAMASLHQPKVDYEYYVNLAVTTNSLIGTSAFVLASLEIERMG

Enzyme Prediction     

No EC number prediction in P168DRAFT_244751-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	50	404	5e-45	0.9518072289156626

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	1.95e-29	50	405	30	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	1.46e-28	122	404	102	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE47860.1|GH105	3.85e-102	18	377	97	496
UJO17900.1|GH105	2.52e-69	28	405	37	398
SMQ49260.1|GH105	4.30e-67	28	405	37	424
SMY22959.1|GH105	6.04e-67	28	405	37	424
SMR50265.1|GH105	6.37e-67	28	405	39	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.12e-26	22	405	2	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.09e-24	122	405	110	367	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.97e-23	122	405	100	357	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	3.65e-23	122	405	110	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.06e-18	169	401	4	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.06e-18	169	401	4	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999730	CS pos: 21-22. Pr: 0.9390

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_244751-t37_1-p1.