CAZyme Information: P168DRAFT_244525-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_244525-t37_1-p1
• CAZy Family: AA9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		90450.46	5.7294

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000016:52395-54936(+)

Full Sequence      

MAFDVETVLSQLTEQDKIALLSGTSDFWHTHSIPSHQVPPIRLTDGPNGIRGTKFFAGVP
AACLPCGTALAATWDAPLLEKAGVLLAKECISKGAHCWLGPTVNIPRSPLGGRGFESFSE
DPHLSGIIASAMIRGCESKGIVSAVKHFVCNDQEHERRAVDVLVTPRALREIYLKPFQIV
ARDARPGALMTSYNKINGKHVVEDEKMLNGLLRTEWGWDPLIISDWYGTYSTVDSLNAGM
DLEMPGVSRYRGRYIESALQARLVKASTVDERARRVLSFVNRMSEVSVSNVEKGRDYPED
RALNRDVCASSIVLLKNDGGLLPLKKDAQTIALIGSHVMAPSISGGGSASLRPYYAVSLY
EAVREAVPNAKIICETGAYSHKMMPVIERLLSNAVINFYNSPVSDVGRECLHTEPVSTTG
FQFMDFRAPGLNRECFWATLVGDFTPDATGIWDFGLSVFGTANLYLDDELVIDNTSHQTK
GTSFFGKGTVEERGSKTLESGRSYKIRLEFGSANTTTMKTVGMVNFGGGAANLGASLRLT
PDDMLNSAVNAATEADYAIVCTGLNPDWESEGFDRASMDLPPGVDKLISSVLSVAKDKTV
IVNHSGTPVTMSWEPQAQAIIQAWYGGNETGHGVADVLFGNLSPSGKLPLSWPSDVRHNP
SYLNFGSVGGRVLYGEDVYVGYRFYDKTRCPPLFPFGHGLSYTTFEISPTVEVGPVSHHT
SLPAAVRVYVKNTGDVPGAEVLQLYVAVPQPAIGRPDKELHGFQKTFLQPGEERAVDITI
DAYATSFWDDIEDKWKSEAGEYELLVGVSSREIVSKGSFILSQTRYWQGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	245	4.9e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.34e-92	65	821	121	764	beta-glucosidase BglX.
224389	BglX	2.80e-67	26	349	48	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	8.91e-58	312	702	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.30e-43	7	781	55	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.77e-36	64	278	88	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP92979.1|GH3	0.0	3	830	5	828
BCS24030.1|GH3	0.0	3	830	5	830
UKZ84262.1|GH3	0.0	1	830	10	839
UKZ48104.1|GH3	0.0	1	830	10	839
UDD60961.1|GH3	0.0	1	830	1	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.24e-234	3	830	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.54e-230	3	830	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	9.48e-142	1	824	1	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.17e-113	9	815	9	657	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.46e-96	5	825	4	717	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U9M7|BGLH_ASPOR	0.0	1	830	1	827	Probable beta-glucosidase H OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglH PE=3 SV=2
sp|B0XM94|BGLH_ASPFC	0.0	3	830	5	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|B8NPL7|BGLH_ASPFN	0.0	1	830	1	827	Probable beta-glucosidase H OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglH PE=3 SV=1
sp|A1CUR8|BGLH_ASPCL	0.0	3	830	5	829	Probable beta-glucosidase H OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	0.0	3	830	5	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999428	0.000589

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_244525-t37_1-p1.