CAZyme Information: P168DRAFT_242876-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_242876-t37_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MSFM01000013|CGC5	54589.74	5.3167

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000013:205516-207084(-)

Full Sequence      

MAIRLSRRWITALILLCGFTVTTTFLHLGLSGSSLIPSDLYHHVTPENDGPPPPDYWEWE
TFTRFAPAPRTPPGAGASNENPDDHLCDSFPTEVLSRVQVVLKMGASEPADRLNPQIETV
TRCIKNLLIVSDREGELRGHRVHDILATLPPSFRVNTTDFDTYEAAKRGDPASMADTQKG
WNLDRFKFLPMVERAYDVNPTAQWFVFLESDTYVVWDNLFRLLDQFNPDRPLYFGSPSPG
RVTGEGEVTWFAYGGAGIVLSAGAIDKAVERTTGAMGDLIQPSLSVQFEQIIKEDCCGDS
VLGWVLFEKGVRLSGLWPMFQPHPLHGVPFDGAYWCQPVITMHKTLPADMYGFMQWENSR
DRSEPLLYSELYEYTKLGTFDHRTDWDNGDWGGWQEPPEAPGHASFEACGTACHDHPECK
GYTYDSTGHCIFIRTMRLGSSKKLLGTTARLSAGWDVGKMKQLQEELNADCKRPRWVKPS
ITRIF

Enzyme Prediction     

No EC number prediction in P168DRAFT_242876-t37_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	4.14e-09	204	267	87	158	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
215605	PLN03153	0.001	200	261	209	270	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW44383.1|GT31	2.99e-231	5	485	6	477
BAE62206.1|GT31	2.44e-230	5	485	6	477
UDD57328.1|GT31	2.44e-230	5	485	6	477
QRD83812.1|GT31	5.70e-229	5	485	6	477
QMW32351.1|GT31	5.70e-229	5	485	6	477

PDB Hits     

P168DRAFT_242876-t37_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0VC84|C1GLT_BOVIN	4.63e-06	171	270	130	225	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Bos taurus OX=9913 GN=C1GALT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000002

TMHMM  Annotations     

Start	End
9	31