CAZyme Information: P168DRAFT_240262-t37_1-p1

Basic Information

• Species: Aspergillus campestris
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus campestris
• CAZyme ID: P168DRAFT_240262-t37_1-p1
• CAZy Family: AA7
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
593	MSFM01000010|CGC2	64671.80	6.2369

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AcampestrisIBT28561	9929	1392248	173	9756

• Gene Location: location=MSFM01000010:1430093-1432126(-)

Full Sequence      

MGAAIPSDSRSPAPKLTFEYIVVGGGTAGNVVATRLAQRGFRVALVEAGGLYQAQSLEAI
PAAATLYIGTSPHVRSAIDWGFVAENQAGVNGRSLHYARGKCLGGSSAMNLMIYQRPSRG
AMEQWASAVNDSSYTFDQVLPYFKRSVHFTPPNTRKRLRNATTSYDPDGYDAHGGPLEVS
YPNYASPFSTWAQRGFGAIGIQHTQDFNTGTNMGGQFCSMTLNAQWQTRSSSQASFLATL
HSFSLTVYSNILAKRVVFDRDNRATGVVVQGLLGKPFTLQATREVILSAGAFQSPQLLMV
SGIGPAATLQAHGIGLRVDLPGVGQNMWDHIYLTVNYRVRVSTINTILNNLVALVREALK
WAFYQVGMLTNQNSDYIAFENLPDSVRGGLSNRTREDLTEQFAPDWPEAEYLTGSGFIGD
SADFFLNQPRDGHNYAGILGTLLTPFSRGNVTLRSADTADLPEINPNWLADPADQELAVA
IFKRTRQFFESEPMAGVLDGEEYYPGSDVQSDEEILEYIRNTMSPIWHASCTCKMGVSSD
PMAVVDHEARVFGVQGLRVVDASAFPMLPPGHPSSVVYMLAEKISDAIIQSRR

Enzyme Prediction     

No EC number prediction in P168DRAFT_240262-t37_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	17	590	3.3e-181	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.97e-117	17	588	5	531	choline dehydrogenase; Validated
225186	BetA	1.57e-100	13	593	3	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.25e-43	445	584	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.00e-33	3	592	41	580	Protein HOTHEAD
366272	GMC_oxred_N	6.08e-24	90	330	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UCK58435.1|AA3_2	5.88e-265	17	589	42	613
QMW25940.1|AA3_2|GT4	6.95e-259	17	589	513	1084
QRD88023.1|AA3_2	7.23e-258	17	577	42	601
QMW38021.1|AA3_2|GT4	1.58e-257	17	589	513	1084
QMW40815.1|AA3_2	1.15e-245	4	588	21	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	4.57e-62	18	592	14	530	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
2JBV_A	6.36e-62	18	592	14	530	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3LJP_A	2.38e-61	18	592	14	530	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	2.78e-55	7	583	73	631	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	5.33e-55	7	583	13	571	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A075TRK9|PATE_PENEN	3.88e-183	17	588	51	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A1CFL2|PATE_ASPCL	2.98e-177	17	585	50	621	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.31e-160	1	589	19	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	6.69e-158	17	588	40	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q12062|AFLK_ASPPU	1.33e-139	14	585	71	636	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000019

TMHMM  Annotations     

There is no transmembrane helices in P168DRAFT_240262-t37_1-p1.